papiCox1.fasta 266 Bytes
Newer Older
Eric Coissac committed
1 2 3 4 5 6 7
>LYCA_COX1
RKWIYSTNHKDIGTLYFIFGIWAGMVGTSLSILIRLELGTPGSL
IGDDQIYNTIVTAHAFIMIFFMVMPIMIGGFGNWLIPLMLGAPDMAFPRMNNMSFWLL
PPSLLLLISSSIVENGAGTGWTVYPPLSSNIAHSGSSVDLAIFSLHLAGISSILGAIN
FITTIINMRINNLSFDQMSLFIWAVGITALLLLLSLPVLAGAITMLLTDRNLNTSFFD
PAGGGDPILYQ