ORG.Annotate issueshttps://git.metabarcoding.org/org-asm/org-annotate/-/issues2022-09-18T15:47:58Zhttps://git.metabarcoding.org/org-asm/org-annotate/-/issues/23شركة صيانة مسابح بالدمام2022-09-18T15:47:58ZAltanzyf Almethalyشركة صيانة مسابح بالدماميتم ترشيح مياه الحمامات عن طريق مصافي كبيرة، فتنظف هذه المصافي المياه من الطحالب والأجسام الصلبة والأوساخ، ويوجد منها ثلاثة أنواع وهي المرشحات الدياتومية، والمرشحات الخرطوشية، والمرشحات الرملية.
تستخدم المعقمات مادتي البروم والكلور لتعقيم المياه، وهي من أشهر المواد الكيميائية المستخدمة لهذا، حيث يكون الكلور المستخدم في التعقيم على شكل ألواح أو حبيبات سائلة أو على شكل سائل، أما البروم فيكون على شكل خليط كيميائي جاف أو قضبان أو ألواح، وتعقم هذه المواد المياه من الجراثيم والبكتيريا وتمنع نمو الطحالب.
[شركة صيانة مسابح بالدمام]( https://www.falcon-clean.com/%d8%b4%d8%b1%d9%83%d8%a9-%d8%b5%d9%8a%d8%a7%d9%86%d8%a9-%d9%85%d8%b3%d8%a7%d8%a8%d8%ad-%d8%a8%d8%a7%d9%84%d8%af%d9%85%d8%a7%d9%85/)
وضع مصائد العث المصصمة خصيصاً لذلك في الخزانة حيث يعتمد مبدأ عملها على جذب العث ثمّ لصقه بها، كما يمكن استخدام مصيدة الصاعقة التي تجذب العث لها، وتصعقه، وهنالك طريقة يدوية لصنع مصيدة العث من خلال تعليق ورق خشن في الخزانة بعد دهنه بمقدار من هلام الصبار أو زيت السمك، لجذب العث والتصاقه بها.
مكن استعمال كرات العث للتخلص من عث الملابس باتباع الإرشادات المرفقة مع المنتج لمعرفة كيفية الاستخدام والكمية المسموح بها، وبشكلٍ عام يجب عدم وضعها بطريقة عشوائية أو مبعثرة بل وضعها داخل أكياس بلاستيكية كبيرة داخل الحقائب أو الصناديق، ويجدر بالذكر إلى أنّ هذه الكرات تحتوي على مركبات متطايرة ضارة كالنفثالين، لذلك يفضل تجنّب استعمالها في الأماكن التي قد يصل لها الأطفال أو الحيوانات الأليفة.
[شركة مكافحة حشرات]( https://www.falcon-clean.com/)يتم ترشيح مياه الحمامات عن طريق مصافي كبيرة، فتنظف هذه المصافي المياه من الطحالب والأجسام الصلبة والأوساخ، ويوجد منها ثلاثة أنواع وهي المرشحات الدياتومية، والمرشحات الخرطوشية، والمرشحات الرملية.
تستخدم المعقمات مادتي البروم والكلور لتعقيم المياه، وهي من أشهر المواد الكيميائية المستخدمة لهذا، حيث يكون الكلور المستخدم في التعقيم على شكل ألواح أو حبيبات سائلة أو على شكل سائل، أما البروم فيكون على شكل خليط كيميائي جاف أو قضبان أو ألواح، وتعقم هذه المواد المياه من الجراثيم والبكتيريا وتمنع نمو الطحالب.
[شركة صيانة مسابح بالدمام]( https://www.falcon-clean.com/%d8%b4%d8%b1%d9%83%d8%a9-%d8%b5%d9%8a%d8%a7%d9%86%d8%a9-%d9%85%d8%b3%d8%a7%d8%a8%d8%ad-%d8%a8%d8%a7%d9%84%d8%af%d9%85%d8%a7%d9%85/)
وضع مصائد العث المصصمة خصيصاً لذلك في الخزانة حيث يعتمد مبدأ عملها على جذب العث ثمّ لصقه بها، كما يمكن استخدام مصيدة الصاعقة التي تجذب العث لها، وتصعقه، وهنالك طريقة يدوية لصنع مصيدة العث من خلال تعليق ورق خشن في الخزانة بعد دهنه بمقدار من هلام الصبار أو زيت السمك، لجذب العث والتصاقه بها.
مكن استعمال كرات العث للتخلص من عث الملابس باتباع الإرشادات المرفقة مع المنتج لمعرفة كيفية الاستخدام والكمية المسموح بها، وبشكلٍ عام يجب عدم وضعها بطريقة عشوائية أو مبعثرة بل وضعها داخل أكياس بلاستيكية كبيرة داخل الحقائب أو الصناديق، ويجدر بالذكر إلى أنّ هذه الكرات تحتوي على مركبات متطايرة ضارة كالنفثالين، لذلك يفضل تجنّب استعمالها في الأماكن التي قد يصل لها الأطفال أو الحيوانات الأليفة.
[شركة مكافحة حشرات]( https://www.falcon-clean.com/)https://git.metabarcoding.org/org-asm/org-annotate/-/issues/22ça marche plus2021-10-21T15:29:57ZEric Coissacça marche plushttps://git.metabarcoding.org/org-asm/org-annotate/-/issues/21Problem with closely related protein genes2018-08-25T11:39:06ZEric CoissacProblem with closely related protein genesAs example psaA and psaB are two closely related proteins. Therefore the soft annotate at the *psaA* locus a *psaA* gene (that is ok) and a *psaB* gene (that is wrong) and the opposite at the *psaB* locusAs example psaA and psaB are two closely related proteins. Therefore the soft annotate at the *psaA* locus a *psaA* gene (that is ok) and a *psaB* gene (that is wrong) and the opposite at the *psaB* locushttps://git.metabarcoding.org/org-asm/org-annotate/-/issues/20Compilation error for exonerate on ubuntu 16.042018-08-25T11:39:06ZEric CoissacCompilation error for exonerate on ubuntu 16.04The library pthread is not correctly linked The library pthread is not correctly linked https://git.metabarcoding.org/org-asm/org-annotate/-/issues/19Add a source feature2018-08-25T11:39:06ZEric CoissacAdd a source featureSome data about the structure of this feature
```
FT source 1..{sequence length}
FT /organism="{organism}"
FT /organelle="plastid:chloroplast"
FT /mol_type="genomic DNA"
FT /{identifier}="{ID}"
```
```
/organelle="chromatophore"
/organelle="hydrogenosome"
/organelle="mitochondrion"
/organelle="nucleomorph"
/organelle="plastid"
/organelle="mitochondrion:kinetoplast"
/organelle="plastid:chloroplast"
/organelle="plastid:apicoplast"
/organelle="plastid:chromoplast"
/organelle="plastid:cyanelle"
/organelle="plastid:leucoplast"
/organelle="plastid:proplastid"
```
Some data about the structure of this feature
```
FT source 1..{sequence length}
FT /organism="{organism}"
FT /organelle="plastid:chloroplast"
FT /mol_type="genomic DNA"
FT /{identifier}="{ID}"
```
```
/organelle="chromatophore"
/organelle="hydrogenosome"
/organelle="mitochondrion"
/organelle="nucleomorph"
/organelle="plastid"
/organelle="mitochondrion:kinetoplast"
/organelle="plastid:chloroplast"
/organelle="plastid:apicoplast"
/organelle="plastid:chromoplast"
/organelle="plastid:cyanelle"
/organelle="plastid:leucoplast"
/organelle="plastid:proplastid"
```
https://git.metabarcoding.org/org-asm/org-annotate/-/issues/17add the gap feature2018-08-25T11:39:06ZEric Coissacadd the gap feature# Optional gap feature:
```
FT gap {X..Y}
FT /estimated_length={unknown or known}
```
Unknown length is represented with 100Ns in the sequence. For known length, please replace with the number of Ns.
http://www.ebi.ac.uk/ena/submit/entry-upload-templates# Optional gap feature:
```
FT gap {X..Y}
FT /estimated_length={unknown or known}
```
Unknown length is represented with 100Ns in the sequence. For known length, please replace with the number of Ns.
http://www.ebi.ac.uk/ena/submit/entry-upload-templateshttps://git.metabarcoding.org/org-asm/org-annotate/-/issues/16line /inference="detect pass:pass1:core"2018-08-25T11:39:06ZMartí Boledaline /inference="detect pass:pass1:core"All CDS annotated have the line /inference="detect pass:pass1:core" below /inference="similar to DNA sequence..."All CDS annotated have the line /inference="detect pass:pass1:core" below /inference="similar to DNA sequence..."https://git.metabarcoding.org/org-asm/org-annotate/-/issues/14blastx concurency issue2018-08-25T11:39:06ZAlain Viariblastx concurency issuethere is a concurency issue when running cds detector
in blastx mode (PASS1_SPEEDUP 1) on several processors
I don't know yet if it comes from the formatting step
or the blast step (I suspect the former)
until this is fixed, don't change teh default settings
(PASS1_SPEEDUP 0)
there is a concurency issue when running cds detector
in blastx mode (PASS1_SPEEDUP 1) on several processors
I don't know yet if it comes from the formatting step
or the blast step (I suspect the former)
until this is fixed, don't change teh default settings
(PASS1_SPEEDUP 0)
Alain ViariAlain Viarihttps://git.metabarcoding.org/org-asm/org-annotate/-/issues/11The problem is : "How do we decide if a chloroplast has inverted repeats ?"2018-08-25T11:39:06ZEric CoissacThe problem is : "How do we decide if a chloroplast has inverted repeats ?"Which rule has to be implemented to decide if a chloroplast genome has got an inverted repeat structure ?
Because for plant without inverted repeat the current algorithm can have some strange behavior.
Moreover it would be nice to not include annotations corresponding to these structures.Which rule has to be implemented to decide if a chloroplast genome has got an inverted repeat structure ?
Because for plant without inverted repeat the current algorithm can have some strange behavior.
Moreover it would be nice to not include annotations corresponding to these structures.https://git.metabarcoding.org/org-asm/org-annotate/-/issues/8Exon numbering and reordering is (sometimes) wrong2018-08-25T11:39:06ZAlain ViariExon numbering and reordering is (sometimes) wrongthis should be fixed in cds detector formatting not in org-annotate.sh
```
FT gene complement(4937..6067)
FT /gene="rps16"
FT /locus_tag=""
FT CDS complement(join(4937..5163,6028..6067))
FT /codon_start=1
FT /transl_table=11
FT /gene="rps16"
FT /locus_tag=""
FT /product="ribosomal protein S16"
FT /inference="similar to DNA sequence:NC_007898:LyesC2p087"
FT /translation="MVKLRLKRCGRKQRAVYRIVAIDVRSRREGKDLQKVGFYDPIKNQ
FT TYLNVPAILYFLEKGAQPTETVQDILKKAEVFKELRLNQPKFN"
FT exon complement(6028..6067)
FT /gene="rps16"
FT /locus_tag=""
FT /number=2
FT exon complement(4937..5163)
FT /gene="rps16"
FT /locus_tag=""
FT /number=1
```this should be fixed in cds detector formatting not in org-annotate.sh
```
FT gene complement(4937..6067)
FT /gene="rps16"
FT /locus_tag=""
FT CDS complement(join(4937..5163,6028..6067))
FT /codon_start=1
FT /transl_table=11
FT /gene="rps16"
FT /locus_tag=""
FT /product="ribosomal protein S16"
FT /inference="similar to DNA sequence:NC_007898:LyesC2p087"
FT /translation="MVKLRLKRCGRKQRAVYRIVAIDVRSRREGKDLQKVGFYDPIKNQ
FT TYLNVPAILYFLEKGAQPTETVQDILKKAEVFKELRLNQPKFN"
FT exon complement(6028..6067)
FT /gene="rps16"
FT /locus_tag=""
FT /number=2
FT exon complement(4937..5163)
FT /gene="rps16"
FT /locus_tag=""
FT /number=1
```https://git.metabarcoding.org/org-asm/org-annotate/-/issues/7Locus tag for CDS is empty2018-08-25T11:39:06ZEric CoissacLocus tag for CDS is empty
```
FT /locus_tag=""
```
There is no locus tag for the other features.
```
FT /locus_tag=""
```
There is no locus tag for the other features.
https://git.metabarcoding.org/org-asm/org-annotate/-/issues/4CDS detector2018-08-25T11:39:06ZAlain ViariCDS detectoro CDS speedup à tester
o CDS speedup à tester
Alain ViariAlain Viari