Commit 9be1f2c2 authored by Alain Viari's avatar Alain Viari

cds test on core and shell

parent f73133dc
......@@ -14,5 +14,3 @@ rpl23 rpl23 787 1:782_2:2_3:1_4:2 POLYEX ribosomal_protein_L23
rpl32 rpl32 474 1:474 MONEX ribosomal_protein_L32
rps15 rps15 480 1:479_2:1 POLYEX ribosomal_protein_S15
rps7 rps7 853 1:853 MONEX ribosomal_protein_S7
ycf1 ycf1 408 1:406_2:2 POLYEX hypothetical_chloroplast_RF1
ycf2 ycf2 654 1:649_2:5 POLYEX Ycf2
ycf1 ycf1 408 1:406_2:2 POLYEX hypothetical_chloroplast_RF1
ycf2 ycf2 654 1:649_2:5 POLYEX Ycf2
......@@ -278,7 +278,7 @@ FT /gene="ycf1"
FT /locus_tag=""
FT /product="hypothetical chloroplast RF1"
FT /inference="similar to DNA sequence:AC_000188:LyesCp019"
FT /inference="detect pass:pass1:core"
FT /inference="detect pass:pass1:shell"
FT /translation="MIFQSFLLGNLVSLCMKIINSVVVVGLYYGFLTTFSIGPSYLFLL
FT RALVMEEGTEKKVSATTGFITGQLMMFISIYYAPLHLALGRPHTITVLALPYLLFHFFW
FT NNHKHFFDYGSTTRNSMRNLSIQCVFLNNLIFQLFNHFILPSSMLARLVNIYLFRCNNK
......@@ -322,7 +322,7 @@ FT /gene="ycf2"
FT /locus_tag=""
FT /product="Ycf2"
FT /inference="similar to DNA sequence:AC_000188:LyesCp004"
FT /inference="detect pass:pass1:core"
FT /inference="detect pass:pass1:shell"
FT /translation="MRGHQFKSWIFELREILREIKNSHHFLDSWTQFNSVGSFIHIFFH
FT QERFLKLFDPRIWSILLSRNSQGSPSNRYFTIKGVILFVVAVLIYRINNRNMVERKNLY
FT LIGLLPIPMNSIGPRNDTLEESVGSSNINRLIVSLLYLPKGKKISESCFLNPKESTWVL
......
Markdown is supported
0% or
You are about to add 0 people to the discussion. Proceed with caution.
Finish editing this message first!
Please register or to comment