Commit 6be837df authored by alain viari's avatar alain viari

go_pass1 moved to bin

parent 412798e7
......@@ -12,3 +12,5 @@ o CDS speedup à tester
o CDS ajouter tools/dbchloro et tools/compare
o $red
......@@ -15,6 +15,7 @@
#========================================================================================
# usage: go_cds.sh fasta
#
unsetenv ORG_SOURCED
setenv ORG_HOME `dirname $0`/../../..
source $ORG_HOME/scripts/csh_init.sh
......@@ -49,7 +50,7 @@ Notify "running pass1: exonerate of $Genome"
foreach f ($fams)
set prot = `basename $f:r`
$LIB_DIR/go_pass1.sh $Fasta $prot $temp
$PROG_DIR/go_pass1.sh $Fasta $prot $temp
end
#
......
......@@ -7,6 +7,7 @@
#
# usage: go_filterbx.sh dna_fasta prot_fasta [idmin nbmin nbmax]
#
unsetenv ORG_SOURCED
setenv ORG_HOME `dirname $0`/../../..
source $ORG_HOME/scripts/csh_init.sh
......
......@@ -17,6 +17,7 @@
#
# usage: go_pass1.sh fasta family [outdir]
#
unsetenv ORG_SOURCED
setenv ORG_HOME `dirname $0`/../../..
source $ORG_HOME/scripts/csh_init.sh
......@@ -100,10 +101,10 @@ endif
if ($PASS1_SPEEDUP != 0) then
$LIB_DIR/go_filterbx.sh $GenoFile $ProtFile \
$PASS1_BLASTX_FILTER_IDMIN \
$PASS1_BLASTX_FILTER_NBMIN \
$PASS1_BLASTX_FILTER_NBMAX > D_$$
$PROG_DIR/go_filterbx.sh $GenoFile $ProtFile \
$PASS1_BLASTX_FILTER_IDMIN \
$PASS1_BLASTX_FILTER_NBMIN \
$PASS1_BLASTX_FILTER_NBMAX > D_$$
set n = `egrep "^>" D_$$ | wc -l`
if ($n > 0) then
......
#!/bin/csh -f
echo "+ [testing CDS]"
setenv ORG_HOME `dirname $0`/../../..
source $ORG_HOME/scripts/csh_init.sh
echo "+ testing CDS"
setenv TMP_CLEANUP 0
setenv PASS1_SPEEDUP 1
setenv PASS1_SLOWDOWN 0
setenv PASS1_BLASTX_FILTER_NBMAX 50
setenv PASS1_BLASTX_FILTER_NBMAX 10
../bin/go_cds.sh test.fst > test.bak
`dirname $0`/../bin/go_cds.sh test.fst > test.bak
diff -q test.bak test.ref >& /dev/null
set stat = $status
if ($stat == 0) then
echo '+ CDS test Ok'
\rm -r test.bak
echo "+ $VTC[3]CDS test Ok$VTC[1]"
\rm -r test.bak test.tmp
else
echo '* CDS test Failure'
echo "* $VTC[2]CDS test Failure$VTC[1]"
endif
exit $stat
......@@ -6,7 +6,7 @@ FT /codon_start=1
FT /transl_table=11
FT /gene="ccsA"
FT /locus_tag=""
FT /product=cytochrome c biogenesis protein
FT /product="cytochrome c biogenesis protein"
FT /inference="similar to DNA sequence:AC_000188:LyesCp084"
FT /translation="MIFSTLEHILTHISFSIVSIVITIHLITFLVDEIVKLYDSSEKGI
FT IVTFFCITGLLVTRWVSSGHFPLSDLYESLIFLSWSFSLIHIIPYFKKNVLILSKITGP
......@@ -22,7 +22,7 @@ FT /codon_start=1
FT /transl_table=11
FT /gene="ndhA_1"
FT /locus_tag=""
FT /product=NADH dehydrogenase subunit 1
FT /product="NADH dehydrogenase subunit 1"
FT /inference="similar to DNA sequence:AC_000188:LyesCp085"
FT /translation="LSNSLSTVDIVEAQSKYGFWGWNLWRQPIGFIVFLISSLAECERL
FT PFDLPEAEEELVAGYQTEYSGIKFGLFYIASYLNLLVSSLFVTVLYLGGWNLSIPYIFV
......@@ -36,7 +36,7 @@ FT /codon_start=1
FT /transl_table=11
FT /gene="ndhA_2"
FT /locus_tag=""
FT /product=NADH dehydrogenase subunit 1
FT /product="NADH dehydrogenase subunit 1"
FT /inference="similar to DNA sequence:AC_000188:LyesCp085"
FT /translation="MIIDTTEIETINSFSKLESLKEVYGIIWMLVPIVTLVLGITIGVL
FT VIVWLEREISAGIQQRIGPEYAGPLGILQALADGTKLLLKENLIPSTGDTRLFSIGPSI
......@@ -50,7 +50,7 @@ FT /codon_start=1
FT /transl_table=11
FT /gene="ndhB"
FT /locus_tag=""
FT /product=NADH dehydrogenase subunit 2
FT /product="NADH dehydrogenase subunit 2"
FT /inference="similar to DNA sequence:NC_008535:CoarCp067"
FT /translation="MIWHVQNENFILDSTRIFMKAFHLLLFDGSLIFPECILIFGLILL
FT LMIDSTSDQKDIPWLYFISSTSLVMSITALLFRWREEPMISFSGNFQTNNFNEIFQFLI
......@@ -78,7 +78,7 @@ FT /codon_start=1
FT /transl_table=11
FT /gene="ndhD"
FT /locus_tag=""
FT /product=NADH dehydrogenase subunit 4
FT /product="NADH dehydrogenase subunit 4"
FT /inference="similar to DNA sequence:NC_007898:LyesC2p017"
FT /translation="MNYFPWLTIIVVFPIFAGSLIFFLPHKGNRVIRWYTICICILELL
FT LTTYAFCYHFQSDDPLIQLVEDYKWIDFFDFHWRLGIDGLSIGPILLTGFITTLATLAA
......@@ -97,8 +97,8 @@ FT /codon_start=1
FT /transl_table=11
FT /gene="ndhE"
FT /locus_tag=""
FT /product=NADH dehydrogenase subunit 4L
FT /inference="similar to DNA sequence:AC_000188:LyesCp080"
FT /product="NADH dehydrogenase subunit 4L"
FT /inference="similar to DNA sequence:NC_001879:NitaCp085"
FT /translation="MILEHVLVLSAYLFSIGIYGLITSRNMVRALMCLELILNAVNINF
FT VTFSDFFDNRQLKGDIFSIFVIAIAAAEAAIGLAIVSSIYRNRKSTRINQSNLLNN"
FT gene complement(11509..13722)
......@@ -109,7 +109,7 @@ FT /codon_start=1
FT /transl_table=11
FT /gene="ndhF"
FT /locus_tag=""
FT /product=NADH dehydrogenase subunit 5
FT /product="NADH dehydrogenase subunit 5"
FT /inference="similar to DNA sequence:AC_000188:LyesCp073"
FT /translation="MEQTYEYAWIIPFIPLPVPMLIGAGLILFPTATKRFRRMWAFQSV
FT LLLSIVMIFSIYLSIQQINSSSVYQYVWSWIINNDFSLDFGYLIDPLTSIMSILITTVG
......@@ -132,7 +132,7 @@ FT /codon_start=1
FT /transl_table=11
FT /gene="ndhG"
FT /locus_tag=""
FT /product=NADH dehydrogenase subunit 6
FT /product="NADH dehydrogenase subunit 6"
FT /inference="similar to DNA sequence:AC_000188:LyesCp077"
FT /translation="MDLSEPIHDFLLVFLGSGLILGGLGVVLLPNPIYSAFSLGLVLVC
FT TSLFYILSNAYFVAAAQLLIYVGAINVLIIFAVMFMNGSEYYKDFHLWTVGDGITSMVC
......@@ -146,7 +146,7 @@ FT /codon_start=1
FT /transl_table=11
FT /gene="ndhH"
FT /locus_tag=""
FT /product=NADH dehydrogenase subunit 7
FT /product="NADH dehydrogenase subunit 7"
FT /inference="similar to DNA sequence:AC_000188:LyesCp078"
FT /translation="MTAPTTRKDLMIVNMGPQHPSMHGVLRLIVTLDGEDVVDCEPILG
FT YLHRGMEKIAENRTIIQYLPYVTRWDYLATMFTEAITINGPEQLGNIQVPKRASYIRVI
......@@ -163,7 +163,7 @@ FT /codon_start=1
FT /transl_table=11
FT /gene="ndhI"
FT /locus_tag=""
FT /product=NADH dehydrogenase subunit I
FT /product="NADH dehydrogenase subunit I"
FT /inference="similar to DNA sequence:AC_000188:LyesCp076"
FT /translation="MLPMITEFINYGQQTIRAARYIGQGFMITLSHANRLPVTIQYPYE
FT KLITSERFRGRIHFEFDKCIACEVCVRVCPIDLPVVDWKLETDIRKKRLLNYSIDFGIC
......@@ -177,8 +177,8 @@ FT /codon_start=1
FT /transl_table=11
FT /gene="psaC"
FT /locus_tag=""
FT /product=photosystem I subunit VII
FT /inference="similar to DNA sequence:NC_022409:CEXI_CP_p076"
FT /product="photosystem I subunit VII"
FT /inference="similar to DNA sequence:NC_023792:CP89_p014"
FT /translation="MSHSVKIYDTCIGCTQCVRACPTDVLEMIPWDGCKAKQIASAPRT
FT EDCVGCKRCESACPTDFLSVRVYLWHETTRSMGLAY"
FT gene 53817..55307
......@@ -189,8 +189,8 @@ FT /codon_start=1
FT /transl_table=11
FT /gene="rpl2"
FT /locus_tag=""
FT /product=ribosomal protein L2
FT /inference="similar to DNA sequence:AC_000188:LyesCp030"
FT /product="ribosomal protein L2"
FT /inference="similar to DNA sequence:NC_007898:LyesC2p002"
FT /translation="MAIHLYKTSTPSTRNGTVDSQVKSNPRNNLIYGQRRCGKGRNARG
FT IITARHRGGGHKRLYRKIDFRRNEKDIYGRIVTIEYDPNRNAYICLIHYGDGEKRYILH
FT PRGAIIGDTIVSGTEVPIKMGNALPSTDMPLGTAIHNIEITLGKGGQLARAAGAVAKLI
......@@ -212,8 +212,8 @@ FT /codon_start=1
FT /transl_table=11
FT /gene="rpl23"
FT /locus_tag=""
FT /product=ribosomal protein L23
FT /inference="similar to DNA sequence:AC_000188:LyesCp026"
FT /product="ribosomal protein L23"
FT /inference="similar to DNA sequence:NC_007898:LyesC2p003"
FT /translation="MDGIKYAVFTDKSIRLLGKNQYTSNVESGSTRTEIKHWVELFFGV
FT KVIAMNSHRLPGKSRRMGPIMGHTMHYRRMIITLQPGYSIPPLRKKRT"
FT gene 14505..14672
......@@ -224,7 +224,7 @@ FT /codon_start=1
FT /transl_table=11
FT /gene="rpl32"
FT /locus_tag=""
FT /product=ribosomal protein L32
FT /product="ribosomal protein L32"
FT /inference="similar to DNA sequence:AC_000188:LyesCp036"
FT /translation="MAVPKKRTSTSKKRIRKNIWKRKGYWVALKAFSLAKSLSTGNSKS
FT FFVRQTKINK"
......@@ -236,7 +236,7 @@ FT /codon_start=1
FT /transl_table=11
FT /gene="rps15"
FT /locus_tag=""
FT /product=ribosomal protein S15
FT /product="ribosomal protein S15"
FT /inference="similar to DNA sequence:AC_000188:LyesCp029"
FT /translation="MVKNSVISVISQEEKKGSVEFQVFNFTNKIRRLTSHLELHKKDYL
FT SQRGLKKILGKRQRLLAYLAKKNRVRYKELINRLDIRETKTR"
......@@ -248,8 +248,8 @@ FT /codon_start=1
FT /transl_table=11
FT /gene="rps7"
FT /locus_tag=""
FT /product=ribosomal protein S7
FT /inference="similar to DNA sequence:AC_000188:LyesCp008"
FT /product="ribosomal protein S7"
FT /inference="similar to DNA sequence:NC_007898:LyesC2p007"
FT /translation="MSRRGTAEKKTAKSDPIYRNRLVNMLVNRILKHGKKSLAYQIIYR
FT AVKKIQQKTETNPLSVLRQAIRGVTPDITVKARRVGGSTHQVPIEIGSTQGKALAIRWL
FT LAASRKRPGRNMAFKLSSELVDAAKGSGDAIRKKEETHRMAEANRAFAHFR"
......@@ -261,7 +261,7 @@ FT /codon_start=1
FT /transl_table=11
FT /gene="ycf1"
FT /locus_tag=""
FT /product=hypothetical chloroplast RF1
FT /product="hypothetical chloroplast RF1"
FT /inference="similar to DNA sequence:AC_000188:LyesCp019"
FT /translation="MIFQSFLLGNLVSLCMKIINSVVVVGLYYGFLTTFSIGPSYLFLL
FT RALVMEEGTEKKVSATTGFITGQLMMFISIYYAPLHLALGRPHTITVLALPYLLFHFFW
......@@ -304,7 +304,7 @@ FT /codon_start=1
FT /transl_table=11
FT /gene="ycf2"
FT /locus_tag=""
FT /product=Ycf2
FT /product="Ycf2"
FT /inference="similar to DNA sequence:AC_000188:LyesCp004"
FT /translation="MRGHQFKSWIFELREILREIKNSHHFLDSWTQFNSVGSFIHIFFH
FT QERFLKLFDPRIWSILLSRNSQGSPSNRYFTIKGVILFVVAVLIYRINNRNMVERKNLY
......
......@@ -44,8 +44,15 @@ if ($?ORG_SOURCED == 0) then
setenv PROG_DIR `dirname $0` # Directory containing
setenv PROG_DIR `cd $PROG_DIR && pwd -P` # the main script file
setenv LIB_DIR "$PROG_DIR/../lib" # Directory containing
setenv LIB_DIR `cd $LIB_DIR && pwd -P` # the main script libraries
if (-d "$PROG_DIR/../lib") then
setenv LIB_DIR "$PROG_DIR/../lib" # Directory containing
setenv LIB_DIR `cd $LIB_DIR && pwd -P` # the main script libraries
else if (-d "$PROG_DIR/lib") then
setenv LIB_DIR "$PROG_DIR/lib" # alternate location
setenv LIB_DIR `cd $LIB_DIR && pwd -P` #
else
setenv LIB_DIR "$PROG_DIR" # alternate location
endif
setenv CALL_DIR `pwd -P` # Directory from where the
# main script is called
......@@ -121,6 +128,17 @@ alias Cat 'awk '"'"'{print "# " $0}'"'"' \!:*'
alias AssignUndef 'if ($?\!:1 == 0) set \!:1=\!:2-*'
# --------------------------------------
# VT100 color codes
# 1: normal 2: red 3: green 4: blue 5: magenta
# --------------------------------------
if ($?ORG_NO_COLOR != 0) then
set VTC = ('' '' '' '' '')
else
set VTC = ('' '' '' '' '')
endif
# --------------------------------------
# reset Stat each time
# --------------------------------------
......
Markdown is supported
0% or
You are about to add 0 people to the discussion. Proceed with caution.
Finish editing this message first!
Please register or to comment