test.ref 20.6 KB
Newer Older
alain viari committed
1 2 3 4 5 6 7 8
FT   gene            15766..16707
FT                   /gene="ccsA"
FT                   /locus_tag=""
FT   CDS             15766..16707
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ccsA"
FT                   /locus_tag=""
alain viari committed
9
FT                   /product="cytochrome c biogenesis protein"
alain viari committed
10
FT                   /inference="similar to DNA sequence:AC_000188:LyesCp084"
Alain Viari committed
11
FT                   /inference="detect pass:pass1:core"
alain viari committed
12 13 14 15 16 17 18 19 20 21 22 23 24 25
FT                   /translation="MIFSTLEHILTHISFSIVSIVITIHLITFLVDEIVKLYDSSEKGI
FT                   IVTFFCITGLLVTRWVSSGHFPLSDLYESLIFLSWSFSLIHIIPYFKKNVLILSKITGP
FT                   SAILTQGFATSGILTEIHQSGILVPALQSEWLIMHVSMMILGYAALLCGSLLSVALLVI
FT                   TFRKNRKLFSKSNVFLNESFFLGENVVENTSFFCTKNYYRSQLIQQLDYWSYRVISLGF
FT                   TFLTIGILSGAVWANEAWGSYWNWDPKETWAFITWIVFAIYLHTRTNRNLRGPNSAIVA
FT                   SIGFLIIWICYFGVNLLGIGLHSYGSFPSTFN"
FT   gene            complement(21114..>21653)
FT                   /gene="ndhA_1"
FT                   /locus_tag=""
FT   CDS             complement(21114..>21653)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ndhA_1"
FT                   /locus_tag=""
alain viari committed
26
FT                   /product="NADH dehydrogenase subunit 1"
alain viari committed
27
FT                   /inference="similar to DNA sequence:AC_000188:LyesCp085"
Alain Viari committed
28
FT                   /inference="detect pass:pass1:core"
alain viari committed
29 30 31 32 33 34 35 36 37 38 39 40
FT                   /translation="LSNSLSTVDIVEAQSKYGFWGWNLWRQPIGFIVFLISSLAECERL
FT                   PFDLPEAEEELVAGYQTEYSGIKFGLFYIASYLNLLVSSLFVTVLYLGGWNLSIPYIFV
FT                   PDIFGINKGGKVFGTLIGIFITLAKTYLFLFIPIATRWTLPRLRMDQLLNLGWKFLLPI
FT                   SLGNLLLTTSSQLLSL"
FT   gene            complement(22772..23338)
FT                   /gene="ndhA_2"
FT                   /locus_tag=""
FT   CDS             complement(22772..23338)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ndhA_2"
FT                   /locus_tag=""
alain viari committed
41
FT                   /product="NADH dehydrogenase subunit 1"
alain viari committed
42
FT                   /inference="similar to DNA sequence:AC_000188:LyesCp085"
Alain Viari committed
43
FT                   /inference="detect pass:pass1:core"
alain viari committed
44 45 46 47 48 49 50
FT                   /translation="MIIDTTEIETINSFSKLESLKEVYGIIWMLVPIVTLVLGITIGVL
FT                   VIVWLEREISAGIQQRIGPEYAGPLGILQALADGTKLLLKENLIPSTGDTRLFSIGPSI
FT                   AVISIFLSYSVIPFGDHLVLADLSIGVFFWIAISSIAPVGLLMSGYGSNNKYSFLGGLR
FT                   AAAQSISYEIPLALCVLSISLRVIR"
FT   gene            42910..45121
FT                   /gene="ndhB"
FT                   /locus_tag=""
alain viari committed
51
FT   CDS             join(42910..43685,44365..45121)
alain viari committed
52 53 54 55
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ndhB"
FT                   /locus_tag=""
alain viari committed
56
FT                   /product="NADH dehydrogenase subunit 2"
alain viari committed
57
FT                   /inference="similar to DNA sequence:AC_000188:LyesCp066"
Alain Viari committed
58
FT                   /inference="detect pass:pass1:core"
alain viari committed
59 60 61 62
FT                   /translation="MIWHVQNENFILDSTRIFMKAFHLLLFDGSLIFPECILIFGLILL
FT                   LMIDSTSDQKDIPWLYFISSTSLVMSITALLFRWREEPMISFSGNFQTNNFNEIFQFLI
FT                   LLCSTLCIPLSVEYIECTEMAITEFLLFVLTATLGGMFLCGANDLITIFVAPECFSLCS
FT                   YLLSGYTKKDVRSNEATMKYLLMGGASSSILVHGFSWLYGSSGGEIELQEIVNGLINTQ
alain viari committed
63 64 65 66 67 68
FT                   MYNSPGISIALIFITVGIGFKLSPAPSHQWTPDVYEGSPTPVVAFLSVTSKVAASASAT
FT                   RIFNIPFYFSSNEWHLLLEILAILSMILGNLIAITQTSMKRMLAYSSIGQIGYVIIGII
FT                   VGDSNDGYASMITYMLFYISMNLGTFACIVLFGLRTGTDNIRDYAGLYTKDPFLALSLA
FT                   LCLLSLGGLPPLAGFFGKLYLFWCGWQAGLYFLVLIGLLTSVVSIYYYLKIIKLLMTGR
FT                   NQEITPHVRNYRRSPLRSNNSIELSMIVCVIASTIPGISMNPIIAIAQDSLF"
FT   exon            42910..43685
alain viari committed
69 70 71
FT                   /gene="ndhB"
FT                   /locus_tag=""
FT                   /number=1
alain viari committed
72
FT   exon            44365..45121
alain viari committed
73 74 75 76 77 78 79 80 81 82 83
FT                   /gene="ndhB"
FT                   /locus_tag=""
FT                   /number=2
FT   gene            complement(16945..18447)
FT                   /gene="ndhD"
FT                   /locus_tag=""
FT   CDS             complement(16945..18447)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ndhD"
FT                   /locus_tag=""
alain viari committed
84
FT                   /product="NADH dehydrogenase subunit 4"
alain viari committed
85
FT                   /inference="similar to DNA sequence:AC_000188:LyesCp081"
Alain Viari committed
86
FT                   /inference="detect pass:pass1:core"
alain viari committed
87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103
FT                   /translation="MNYFPWLTIIVVFPIFAGSLIFFLPHKGNRVIRWYTICICILELL
FT                   LTTYAFCYHFQSDDPLIQLVEDYKWIDFFDFHWRLGIDGLSIGPILLTGFITTLATLAA
FT                   WPVTRDSRLFHFLMLAMYSGQIGLFSSRDLLLFFIMWELELIPVYLLLAMWGGKKRLYS
FT                   ATKFILYTAGGSVFLLMGVLGVALYGSNEPTLNFETSVNQSYPVVLEIIFYIGFFIAFA
FT                   VKSPIIPLHTWLPDTHGEAHYSTCMLLAGILLKMGAYGLIRINMELLPHAHSIFSPWLM
FT                   IIGTIQIIYAASTSLGQRNLKKRIAYSSVSHMGFIIIGISSLTDTGLNGALLQIISHGF
FT                   IGAALFFLAGTTYDRIRLVYLDEMGGIAIPMPKMFTMFSSFSMASLALPGMSGFVAELI
FT                   VFFGIITGQKYLLMPKLLITFVMAIGIILTPIYSLSMPRQMFYGYKLFNAPKDSFFDSG
FT                   PRELFLSISIFLPVIGIGIYPDFVLSLAVDKVEVILSNFFYR"
FT   gene            complement(19062..19367)
FT                   /gene="ndhE"
FT                   /locus_tag=""
FT   CDS             complement(19062..19367)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ndhE"
FT                   /locus_tag=""
alain viari committed
104
FT                   /product="NADH dehydrogenase subunit 4L"
alain viari committed
105
FT                   /inference="similar to DNA sequence:AC_000188:LyesCp080"
Alain Viari committed
106
FT                   /inference="detect pass:pass1:core"
alain viari committed
107 108 109 110 111 112 113 114 115 116
FT                   /translation="MILEHVLVLSAYLFSIGIYGLITSRNMVRALMCLELILNAVNINF
FT                   VTFSDFFDNRQLKGDIFSIFVIAIAAAEAAIGLAIVSSIYRNRKSTRINQSNLLNN"
FT   gene            complement(11509..13722)
FT                   /gene="ndhF"
FT                   /locus_tag=""
FT   CDS             complement(11509..13722)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ndhF"
FT                   /locus_tag=""
alain viari committed
117
FT                   /product="NADH dehydrogenase subunit 5"
alain viari committed
118
FT                   /inference="similar to DNA sequence:AC_000188:LyesCp073"
Alain Viari committed
119
FT                   /inference="detect pass:pass1:core"
alain viari committed
120 121 122 123 124 125 126 127 128 129 130 131 132 133 134 135 136 137 138 139 140
FT                   /translation="MEQTYEYAWIIPFIPLPVPMLIGAGLILFPTATKRFRRMWAFQSV
FT                   LLLSIVMIFSIYLSIQQINSSSVYQYVWSWIINNDFSLDFGYLIDPLTSIMSILITTVG
FT                   IMVLIYSDNYMAHDQGYLRFFAYMSFFSTSMLGLVTSSNLIQIYIFWELVGLCSYLLIG
FT                   FWFTRPVAANACQKAFVTNRVGDFGLLLGILGFYWITGSFEFRDLFEIFNNLIYNNELN
FT                   FLFVTLCAVLLFAGAVAKSAQFPLHVWLPDAMEGPTPISALIHAATMVAAGIFLVARLL
FT                   PLFRVIPYIMYLISVIGIITVLLGATLALAQKDIKRGLAYSTMSQLGYMMLALGMGSYR
FT                   SALFHLITHAYSKALLFLGSGSIIHSMETIVGYSPAKSQNMGLMGGLRKHVPITKITFL
FT                   LGTLSLCGIPPLACFWSKDEILNDSWLYSPIFAIIAWATAGLTAFYMFRIYLLTFEGHL
FT                   NAHFQNYGGKQKIPFYSISLWGKNGVKKNSCLLTMNNNESTYFLSKTKYPIAKNGRKMT
FT                   RPFMTIAHFKHKAVSSYPYESDNTMLFPIFVLGLFTLFVGAIGIPFNQEGVNLDILSKW
FT                   LAPSINLLHPKSNNSLDWNEFLKDAVVSVSIAYFGIFIASFLYKPIYSSLKNLEFINSF
FT                   VKKGPKRILWDKILNGIYDWSYNRAYIDAFYTRFFVGGIRGLAEFTHFVDRRVIDGMTN
FT                   GVGVISFIVGEGIKYIGGGRISSYLFLYLAYVSVFLLVYYLLF"
FT   gene            complement(19591..20121)
FT                   /gene="ndhG"
FT                   /locus_tag=""
FT   CDS             complement(19591..20121)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ndhG"
FT                   /locus_tag=""
alain viari committed
141
FT                   /product="NADH dehydrogenase subunit 6"
alain viari committed
142
FT                   /inference="similar to DNA sequence:AC_000188:LyesCp077"
Alain Viari committed
143
FT                   /inference="detect pass:pass1:core"
alain viari committed
144 145 146 147 148 149 150 151 152 153 154 155
FT                   /translation="MDLSEPIHDFLLVFLGSGLILGGLGVVLLPNPIYSAFSLGLVLVC
FT                   TSLFYILSNAYFVAAAQLLIYVGAINVLIIFAVMFMNGSEYYKDFHLWTVGDGITSMVC
FT                   ISLFISLITTISDTSWYGIIWTTRSNQIIEQDFLSNSQQIGIHLSTDFFLPFELISIIL
FT                   LVALIGAIAVARQ"
FT   gene            complement(23340..24521)
FT                   /gene="ndhH"
FT                   /locus_tag=""
FT   CDS             complement(23340..24521)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ndhH"
FT                   /locus_tag=""
alain viari committed
156
FT                   /product="NADH dehydrogenase subunit 7"
alain viari committed
157
FT                   /inference="similar to DNA sequence:AC_000188:LyesCp078"
Alain Viari committed
158
FT                   /inference="detect pass:pass1:core"
alain viari committed
159 160 161 162 163 164 165 166 167 168 169 170 171 172 173
FT                   /translation="MTAPTTRKDLMIVNMGPQHPSMHGVLRLIVTLDGEDVVDCEPILG
FT                   YLHRGMEKIAENRTIIQYLPYVTRWDYLATMFTEAITINGPEQLGNIQVPKRASYIRVI
FT                   MLELSRIASHLLWLGPFMADIGAQTPFFYIFRERELIYDLFEAATGMRMMHNYFRIGGV
FT                   AADLPYGWIDKCLDFCDYFLTGVAEYQKLITRNPIFLERVEGVGIIGRDEALNWGLSGP
FT                   MLRASGIEWDLRKVDHYESYDEFDWQVQWQREGDSLARYLVRIGEMTESIKIIQQALEG
FT                   IPGGPYENLEMRRFDRLKDPEWNDFEYRFISKKPSPTFELSKQELYVRVEAPKGELGIF
FT                   LIGDQSVFPWRWKIRPPGFINLQILPQLVKRMKLADIMTILGSIDIIMGEVDR"
FT   gene            complement(20526..21029)
FT                   /gene="ndhI"
FT                   /locus_tag=""
FT   CDS             complement(20526..21029)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ndhI"
FT                   /locus_tag=""
alain viari committed
174
FT                   /product="NADH dehydrogenase subunit I"
alain viari committed
175
FT                   /inference="similar to DNA sequence:AC_000188:LyesCp076"
Alain Viari committed
176
FT                   /inference="detect pass:pass1:core"
alain viari committed
177 178 179 180 181 182 183 184 185 186 187 188
FT                   /translation="MLPMITEFINYGQQTIRAARYIGQGFMITLSHANRLPVTIQYPYE
FT                   KLITSERFRGRIHFEFDKCIACEVCVRVCPIDLPVVDWKLETDIRKKRLLNYSIDFGIC
FT                   IFCGNCVEYCPTNCLSMTEEYELSTYDRHELNYNQIALGRLPMSVIDDYTIRTISNLPQ
FT                   INNE"
FT   gene            complement(18565..18810)
FT                   /gene="psaC"
FT                   /locus_tag=""
FT   CDS             complement(18565..18810)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="psaC"
FT                   /locus_tag=""
alain viari committed
189
FT                   /product="photosystem I subunit VII"
alain viari committed
190
FT                   /inference="similar to DNA sequence:AC_000188:LyesCp065"
Alain Viari committed
191
FT                   /inference="detect pass:pass1:core"
alain viari committed
192 193 194 195 196 197 198 199 200 201
FT                   /translation="MSHSVKIYDTCIGCTQCVRACPTDVLEMIPWDGCKAKQIASAPRT
FT                   EDCVGCKRCESACPTDFLSVRVYLWHETTRSMGLAY"
FT   gene            53817..55307
FT                   /gene="rpl2"
FT                   /locus_tag=""
FT   CDS             join(53817..54201,54868..55307)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpl2"
FT                   /locus_tag=""
alain viari committed
202
FT                   /product="ribosomal protein L2"
alain viari committed
203
FT                   /inference="similar to DNA sequence:AC_000188:LyesCp030"
Alain Viari committed
204
FT                   /inference="detect pass:pass1:core"
alain viari committed
205 206 207 208 209 210 211 212 213 214 215 216 217 218 219 220 221 222 223 224 225
FT                   /translation="MAIHLYKTSTPSTRNGTVDSQVKSNPRNNLIYGQRRCGKGRNARG
FT                   IITARHRGGGHKRLYRKIDFRRNEKDIYGRIVTIEYDPNRNAYICLIHYGDGEKRYILH
FT                   PRGAIIGDTIVSGTEVPIKMGNALPSTDMPLGTAIHNIEITLGKGGQLARAAGAVAKLI
FT                   AKEGKSATLKLPSGEVRLISKNCSATVGQVGNVGVNQKSLGRAGSKRWLGKRPVVRGVV
FT                   MNPVDHPHGGGEGRAPIGRKKPTTPWGYPALGRRSRKRNKYSDNLILRRRSK"
FT   exon            53817..54201
FT                   /gene="rpl2"
FT                   /locus_tag=""
FT                   /number=1
FT   exon            54868..55307
FT                   /gene="rpl2"
FT                   /locus_tag=""
FT                   /number=2
FT   gene            53517..53798
FT                   /gene="rpl23"
FT                   /locus_tag=""
FT   CDS             53517..53798
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpl23"
FT                   /locus_tag=""
alain viari committed
226
FT                   /product="ribosomal protein L23"
alain viari committed
227
FT                   /inference="similar to DNA sequence:AC_000188:LyesCp026"
Alain Viari committed
228
FT                   /inference="detect pass:pass1:core"
alain viari committed
229 230 231 232 233 234 235 236 237 238
FT                   /translation="MDGIKYAVFTDKSIRLLGKNQYTSNVESGSTRTEIKHWVELFFGV
FT                   KVIAMNSHRLPGKSRRMGPIMGHTMHYRRMIITLQPGYSIPPLRKKRT"
FT   gene            14505..14672
FT                   /gene="rpl32"
FT                   /locus_tag=""
FT   CDS             14505..14672
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpl32"
FT                   /locus_tag=""
alain viari committed
239
FT                   /product="ribosomal protein L32"
alain viari committed
240
FT                   /inference="similar to DNA sequence:AC_000188:LyesCp036"
Alain Viari committed
241
FT                   /inference="detect pass:pass1:core"
alain viari committed
242 243 244 245 246 247 248 249 250 251
FT                   /translation="MAVPKKRTSTSKKRIRKNIWKRKGYWVALKAFSLAKSLSTGNSKS
FT                   FFVRQTKINK"
FT   gene            complement(24633..24896)
FT                   /gene="rps15"
FT                   /locus_tag=""
FT   CDS             complement(24633..24896)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rps15"
FT                   /locus_tag=""
alain viari committed
252
FT                   /product="ribosomal protein S15"
alain viari committed
253
FT                   /inference="similar to DNA sequence:AC_000188:LyesCp029"
Alain Viari committed
254
FT                   /inference="detect pass:pass1:core"
alain viari committed
255 256 257 258 259 260 261 262 263 264
FT                   /translation="MVKNSVISVISQEEKKGSVEFQVFNFTNKIRRLTSHLELHKKDYL
FT                   SQRGLKKILGKRQRLLAYLAKKNRVRYKELINRLDIRETKTR"
FT   gene            42157..42624
FT                   /gene="rps7"
FT                   /locus_tag=""
FT   CDS             42157..42624
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rps7"
FT                   /locus_tag=""
alain viari committed
265
FT                   /product="ribosomal protein S7"
alain viari committed
266
FT                   /inference="similar to DNA sequence:AC_000188:LyesCp008"
Alain Viari committed
267
FT                   /inference="detect pass:pass1:core"
alain viari committed
268 269 270 271 272 273 274 275 276 277 278
FT                   /translation="MSRRGTAEKKTAKSDPIYRNRLVNMLVNRILKHGKKSLAYQIIYR
FT                   AVKKIQQKTETNPLSVLRQAIRGVTPDITVKARRVGGSTHQVPIEIGSTQGKALAIRWL
FT                   LAASRKRPGRNMAFKLSSELVDAAKGSGDAIRKKEETHRMAEANRAFAHFR"
FT   gene            complement(25298..30973)
FT                   /gene="ycf1"
FT                   /locus_tag=""
FT   CDS             complement(25298..30973)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ycf1"
FT                   /locus_tag=""
alain viari committed
279
FT                   /product="hypothetical chloroplast RF1"
alain viari committed
280
FT                   /inference="similar to DNA sequence:AC_000188:LyesCp019"
Alain Viari committed
281
FT                   /inference="detect pass:pass1:shell"
alain viari committed
282 283 284 285 286 287 288 289 290 291 292 293 294 295 296 297 298 299 300 301 302 303 304 305 306 307 308 309 310 311 312 313 314 315 316 317 318 319 320 321 322
FT                   /translation="MIFQSFLLGNLVSLCMKIINSVVVVGLYYGFLTTFSIGPSYLFLL
FT                   RALVMEEGTEKKVSATTGFITGQLMMFISIYYAPLHLALGRPHTITVLALPYLLFHFFW
FT                   NNHKHFFDYGSTTRNSMRNLSIQCVFLNNLIFQLFNHFILPSSMLARLVNIYLFRCNNK
FT                   ILFVTSGFVGWLIGHILFMKWLGLVLVWIRQNHSIRSNKYIRSNKYLVLELRNSMARIF
FT                   SILLFITCVYYLGRIPSPILTKKLKEASKTEERVESEEERDVEIETASEMKGTKQEQEG
FT                   STEEDPYPSPSLFSEEGWDPDKIDETEEIRVNGKDKIKDKFHSHLTETGYNNINTSNSP
FT                   IYDYQDSYLNNNNTGNLENCKLQLLDKKNENQEQDLFWFQKPLVSLLFDYNRWNRPFRY
FT                   IKNNRFEQAVRTEMSQYFFDTCKSDGKQKISFTYPPSLSTFWKMIKRKIPLLSLQKTLP
FT                   NELDTQWVSTNKEKSNNLNKEFLNRLEILDKESLSLDILETRTRFCNDDTKKEYVPKMY
FT                   DPLLNGLYRGTIKKGVSSSIINNTLLENWEKRVRLNRIHTIFLPNIDYQEFEQKAYTID
FT                   KKPLSTEIDEFLTLINELGNEAKSSLNLKGLSLFSDQEQRRANSEKRTKFVKFVFNALD
FT                   PNETKSGKKSIGIKEISKKVPRWSHKLITELDQQMGEFKDRASMDHQLRSRKAKRVVIF
FT                   TDNKATKDAEEEVALISYSQQSDFRRGIITGSMRAQRRKTFISKLFQANVHSPLFVDRI
FT                   TPLRLFSFDISELIKPILKNWTDKEGEFKILESREEQTKREEKKEKDKKEDNKRKEQAR
FT                   IAIEEAWDTIPLAQIIRGYMLITQSILRKYILLPALIIAKNIGRMLFLQLPEWSEDLQE
FT                   WNREMQIKCTYNGVQLSETEFPKNWLRDGIQIKILFPFCLKPWHISKLYPSRRELMKKQ
FT                   KQKDDFCFLTVWGMEAELPFGSPRKRPSFFEPIFKELEKKIGKFKKKYFLTLKILKGKT
FT                   KLFRKVSKETTKLFIKSIGFLKKIKKELSKVNLIVLFRFKEISESNETKKEKDYLISNQ
FT                   IINESFRQIESGNWPNSSLIETKMKDLTNRTSTIKNKIERITKEKKKVTPEIDINPNKT
FT                   NNIKKFESPKKIFQILKSRNTRVIWKFHYFLKLFIQRLYINLFLSIINIPRITTQLFLK
FT                   STNKLIEKFISNNEINQEKINNKKKIHFMFISTIKKSLYNISKKNSHILCDLSYLSQAY
FT                   VFYKLSQTQVINFSKFRSVLQYNTTSCFLKTKIKDYFKTLGIFHSELKHKKLQSYRINQ
FT                   WKNWLRWHYQYDLSQIRWSRLMPKKWRTRVNQSCMAQNKNRNLNKWNSYEKDQLLHYKK
FT                   ENDSELYSLSNEKDNFKKCYGYGLLAYKSINYENKSDSFFSRLPFEVQVKKNLEISYNS
FT                   NTSKHNFVDMPGNLHINNYLRKGNILDRERNLDRKYFDWKIIHFSLRQKGDIEAWVKID
FT                   TNSNPNTKIGINNYQIIDKIEKKGVFYLTTHQNPEKTQKNSKKFFFDWMGMNEKIFNRP
FT                   ILNLEFWFFPEFVLLYNVYKIKPWIIPSKFLLFNLNTNKNVSQNKNQNFFLPSNKKIKI
FT                   KNRSQEAKEPPSQRERGSDIENKGNLSPVFSKHQTDLEKDYVESDTKKGKNKKQYKSNT
FT                   EAELDLFLKRYLLFQLRWNGALNQRMFENIKVYCLLLRLINPTKITISSIQRREMSLDI
FT                   MLIQANLPLTDLMKKGVLIIEPIRLSVKDNGQFIMYQTIGISLIHKSKHQTNQRYREQR
FT                   YVDKKNFDEFILQPQTQRINTEKTHFGLLVPENILWSRRRRELRIRSFFNSWNWNVVDR
FT                   NSVFCNETNVKNWSQFLGERKPLYKDKNELIKFKFFFWPNYRLEDLACMNRYWFDTNNG
FT                   SRFSILRIHMYPRLKIN"
FT   gene            complement(46313..53149)
FT                   /gene="ycf2"
FT                   /locus_tag=""
FT   CDS             complement(46313..53149)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ycf2"
FT                   /locus_tag=""
alain viari committed
323
FT                   /product="Ycf2"
alain viari committed
324
FT                   /inference="similar to DNA sequence:AC_000188:LyesCp004"
Alain Viari committed
325
FT                   /inference="detect pass:pass1:shell"
alain viari committed
326 327 328 329 330 331 332 333 334 335 336 337 338 339 340 341 342 343 344 345 346 347 348 349 350 351 352 353 354 355 356 357 358 359 360 361 362 363 364
FT                   /translation="MRGHQFKSWIFELREILREIKNSHHFLDSWTQFNSVGSFIHIFFH
FT                   QERFLKLFDPRIWSILLSRNSQGSPSNRYFTIKGVILFVVAVLIYRINNRNMVERKNLY
FT                   LIGLLPIPMNSIGPRNDTLEESVGSSNINRLIVSLLYLPKGKKISESCFLNPKESTWVL
FT                   PITKKCSMPESNWGSRWWRNWIGKKRDSSCKISNETVAGIEILFKEKDLKYLEFLFVYY
FT                   MDDPIRKDHDWELFDRLSLRKSRNRINLNSGPLFEILVKHWISYLMSAFREKIPIEVEG
FT                   FFKQQGAGSTIQSNDIEHVSHLFSRNKWAISLQNCAQFHMWQFRQDLFVSWGKNPPESD
FT                   FLRNVSRENWIWLDNVWLVNKDRFFSKVQNVSSNIQYDSTRSSFVQVTDSSQLKGSSDQ
FT                   SRDHLDSISNEDSEYHTLINQREIQQRKERSILWDPSFLQTERKEIESGRFPKCLSGYS
FT                   SMSRLFTEREKQMINHLFPEEIEEFLGNPTRSVRSFFSDRWSELHLGSNPTERSTRDQK
FT                   LLKKQQDLSFVPSRRSEKKEMVNIFKIITYLQNTVSIHPISSDPGCDMVPKDEPDMDSS
FT                   NKISFLNKNPFFDLFHLFHDRNRGGYTLHYDFASEERFQEMADLFTLSITEPDLVYHKG
FT                   FAFSIDSCGLDQKQFLNEARDESKKKSLLVLPPIFYEENESFSRRIRKKWVRISCGNDL
FT                   EDPKPKIVVFASNNIMEAVTQYRLIRNLIQIQYSTYGYIRNVLNRFFLMNRSDRNFEYG
FT                   IQRDQIGKDTLNHRTIMKYTINQYLSNLKKSQKKWFEPLILISRTERSMNRDPDAYRYK
FT                   WSNGSKSFQEHLEQSVSKQKSRFQVVFDRLRINQYSIDWSEVIDKKDLSKSLRFFLSKS
FT                   LLFLSKLLLFLSNSLPFFCVSFGNIPIHRSEIYIYEELKGPNDQLCNQLLESIGLQIVH
FT                   LKKLKPFLLDDHDTSQKSKFLINGGTISPFLFNKIPKWMIDSFHTRNNRRKSFDNPDSY
FT                   FSMIFHDQDNWLNPVKPFHRSSLISSFYKANRLRFLNNPHHFCFYWNTRFPFSVEKARI
FT                   NNSDFTYGQFLNILFIRNKIFSLCVGKKKHAFWGRDTISPIESQVSNIFIPNDFPQSGD
FT                   ETYNLYKSFHFPSRSDPFVRRAIYSIADISGTPLTEGQIVNFERTYCQPLSDMNLSDSE
FT                   GKNLHQYLNFNSNMGLIHTPCSEKDLSSEKRKKWSLCLKKCVEKGQTYRTFQRDSAFST
FT                   LSKWNLFQTYMPWFLTSTGYKYLNLIFLDTFSDLLPILSSSQKFVSIFPDIMHGSGISW
FT                   RILQKKLCLPQWNLISEISSKCLHNLLLSEEMIHRNNESPLISTHLRSPNAREFLYSIL
FT                   FLLLVAGYLVRTHLLFVSRASSELQTEFERVKSLMTPSSMIELRKLLDRYPTSEPNSFW
FT                   LKNLFLVALEQLGDSLEEIRGSASGGNMLGPAYGVKSIRSKKKDWNINLIEIIDLIPNP
FT                   INRITFSRNTRHLSHTSKEIYSLIRKRKNVNGDWIDEKIESWVANSDSIDDEEREFLVQ
FT                   FSTLTTENRIDQILLSLTHSDHLSKNDSGYQMIEQPGAIYLRYLVDIHKKHLMNYEFNP
FT                   SCLAERRIFLAHYQTITYSQTSCGENSFHFPSHGKPFSLRLALSPSRGILVIGSIGTGR
FT                   SYLVKYLATNSYVPFITVFLNKFLDNKSKGFLLDEIDIDDSDDIDDSDNLDASDDIDRD
FT                   LDTELELLTRMNGLTVDMMPEIDRFYITLQFELAKAMSPCIIWIPNIHDLDVNESNDLS
FT                   LGLLVNHLSRDCERCSTRNILVIASTHIPQKVDPALIAPNKLNTCIKIRRLLIPQQRKH
FT                   FFTLSYTRGFHLEKKMFHTNGFGSITMGSNARDLVALTNEVLSISITQKKSIIDTNTIR
FT                   SALHRQTWDLRSQVRSVQDHGILFYQIGRAVAQNVLLSNCPIDPISIYMKKKSCNEGDS
FT                   YLYKWYFELGTSMKRLTILLYLLSCSAGSVAQDLWSLSVPDEKNGITSYGLVENDSDLV
FT                   HGLLEVEGALVGSSRTEKDCSQFDNDRVTLLLRPEPRNPLDMMQKGSWSILDQRFLYEK
FT                   YESEFEEGEGEGALDPQEDLFNHIVWAPRIWRPWGFLFDCIERPNELGFPYWSRSFRGK
FT                   RIIYDEEDELQENDSGFLQSGTMQYQTRDRSQGLFRISQFIWDPADPLFFLFKDQPPGS
FT                   VFSHRELFADEEMSKGLLTSQTDPPTSLYKRWFIKNTQEKHFELLINRQRWLRTNSSLS
FT                   NGSFRSNTLSESYQYLSNLFLSNGTLLDQMPKTLLRKRWLFPDEMKIGFM"