sc_left_VII.embl 70.8 KB
Newer Older
Eric Coissac committed
1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 127 128 129 130 131 132 133 134 135 136 137 138 139 140 141 142 143 144 145 146 147 148 149 150 151 152 153 154 155 156 157 158 159 160 161 162 163 164 165 166 167 168 169 170 171 172 173 174 175 176 177 178 179 180 181 182 183 184 185 186 187 188 189 190 191 192 193 194 195 196 197 198 199 200 201 202 203 204 205 206 207 208 209 210 211 212 213 214 215 216 217 218 219 220 221 222 223 224 225 226 227 228 229 230 231 232 233 234 235 236 237 238 239 240 241 242 243 244 245 246 247 248 249 250 251 252 253 254 255 256 257 258 259 260 261 262 263 264 265 266 267 268 269 270 271 272 273 274 275 276 277 278 279 280 281 282 283 284 285 286 287 288 289 290 291 292 293 294 295 296 297 298 299 300 301 302 303 304 305 306 307 308 309 310 311 312 313 314 315 316 317 318 319 320 321 322 323 324 325 326 327 328 329 330 331 332 333 334 335 336 337 338 339 340 341 342 343 344 345 346 347 348 349 350 351 352 353 354 355 356 357 358 359 360 361 362 363 364 365 366 367 368 369 370 371 372 373 374 375 376 377 378 379 380 381 382 383 384 385 386 387 388 389 390 391 392 393 394 395 396 397 398 399 400 401 402 403 404 405 406 407 408 409 410 411 412 413 414 415 416 417 418 419 420 421 422 423 424 425 426 427 428 429 430 431 432 433 434 435 436 437 438 439 440 441 442 443 444 445 446 447 448 449 450 451 452 453 454 455 456 457 458 459 460 461 462 463 464 465 466 467 468 469 470 471 472 473 474 475 476 477 478 479 480 481 482 483 484 485 486 487 488 489 490 491 492 493 494 495 496 497 498 499 500 501 502 503 504 505 506 507 508 509 510 511 512 513 514 515 516 517 518 519 520 521 522 523 524 525 526 527 528 529 530 531 532 533 534 535 536 537 538 539 540 541 542 543 544 545 546 547 548 549 550 551 552 553 554 555 556 557 558 559 560 561 562 563 564 565 566 567 568 569 570 571 572 573 574 575 576 577 578 579 580 581 582 583 584 585 586 587 588 589 590 591 592 593 594 595 596 597 598 599 600 601 602 603 604 605 606 607 608 609 610 611 612 613 614 615 616 617 618 619 620 621 622 623 624 625 626 627 628 629 630 631 632 633 634 635 636 637 638 639 640 641 642 643 644 645 646 647 648 649 650 651 652 653 654 655 656 657 658 659 660 661 662 663 664 665 666 667 668 669 670 671 672 673 674 675 676 677 678 679 680 681 682 683 684 685 686 687 688 689 690 691 692 693 694 695 696 697 698 699 700 701 702 703 704 705 706 707 708 709 710 711 712 713 714 715 716 717 718 719 720 721 722 723 724 725 726 727 728 729 730 731 732 733 734 735 736 737 738 739 740 741 742 743 744 745 746 747 748 749 750 751 752 753 754 755 756 757 758 759 760 761 762 763 764 765 766 767 768 769 770 771 772 773 774 775 776 777 778 779 780 781 782 783 784 785 786 787 788 789 790 791 792 793 794 795 796 797 798 799 800 801 802 803 804 805 806 807 808 809 810 811 812 813 814 815 816 817 818 819 820 821 822 823 824 825 826 827 828 829 830 831 832 833 834 835 836 837 838 839 840 841 842 843 844 845 846 847 848 849 850 851 852 853 854 855 856 857 858 859 860 861 862 863 864 865 866 867 868 869 870 871 872 873 874 875 876 877 878 879 880 881 882 883 884 885 886 887 888 889 890 891 892 893 894 895 896 897 898 899 900 901 902 903 904 905 906 907 908 909 910 911 912 913 914 915 916 917 918 919 920 921 922 923 924 925 926 927 928 929 930 931 932 933 934 935 936 937 938 939 940 941 942 943 944 945 946 947 948 949 950 951 952 953 954 955 956 957 958 959 960 961 962 963 964 965 966 967 968 969 970 971 972 973 974 975 976 977 978 979 980 981 982 983 984 985 986 987 988 989 990 991 992 993 994 995 996 997 998 999 1000 1001
ID   X94357; SV 1; linear; genomic DNA; STD; FUN; 39411 BP.
XX
AC   X94357;
XX
DT   06-JAN-1996 (Rel. 46, Created)
DT   30-JUN-2006 (Rel. 88, Last updated, Version 8)
XX
DE   S.cerevisiae left telomeric region from chromosome VII
XX
KW   ADH4 gene; FZF1 gene; HXK2 gene; PDE1 gene; RTG2 gene.
XX
OS   Saccharomyces cerevisiae (baker's yeast)
OC   Eukaryota; Fungi; Dikarya; Ascomycota; Saccharomycotina; Saccharomycetes;
OC   Saccharomycetales; Saccharomycetaceae; Saccharomyces.
XX
RN   [1]
RX   DOI; 10.1002/(SICI)1097-0061(199612)12:15<1555::AID-YEA43>3.3.CO;2-H.
RX   PUBMED; 8972578.
RA   Coissac E., Maillier E., Robineau S., Netter P.;
RT   "Sequence of a 39,411 bp DNA fragment covering the left end of chromosome
RT   VII of Saccharomyces cerevisiae";
RL   Yeast 12(15):1555-1562(1996).
XX
RN   [2]
RP   1-39411
RA   Coissac E.;
RT   ;
RL   Submitted (20-DEC-1995) to the EMBL/GenBank/DDBJ databases.
RL   E. Coissac, CNRS, Centre de Genetique Moleculaire, Avenue de la Terrasse,
RL   Gif sur Yvette, F-91198, FRANCE
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..39411
FT                   /organism="Saccharomyces cerevisiae"
FT                   /chromosome="VII"
FT                   /strain="FY1679"
FT                   /mol_type="genomic DNA"
FT                   /note="left telomere"
FT                   /db_xref="taxon:4932"
FT   CDS             2790..3932
FT                   /note="ORF NRC380"
FT                   /db_xref="GOA:P53053"
FT                   /db_xref="InterPro:IPR001142"
FT                   /db_xref="SGD:S000003232"
FT                   /db_xref="UniProtKB/Swiss-Prot:P53053"
FT                   /protein_id="CAA64124.1"
FT                   /translation="MDGAKFENTVAFLPSEIFDCYNSTLPKNVFRSFVTWSCYEKFNSL
FT                   EFRTWLLMWLPLIIAWKIRGKRHYLVIVTALMFEVLYFLWTYSYIFRERTLGKQVSQFA
FT                   KEIITNTPGIDTEDWERVAVNFNSYLYENKLWNTEYFFFDGSSCQEAFRKMLLEPFSLK
FT                   KNDFANAKVPDGSVCYTEKALQVYFTQIERKWHWINSEGFLHNKTTQSVQFSKHGYGSK
FT                   LLWAFKEVTIMNSRFAFFSIAYLNGLLTIPRLRNSLHILYVCAVLSSMIIEYLIGIDKF
FT                   RFKSMNLIHKLQFLSYITCGHEKSDATNWSQIAKRTNTYMFEQKIWNSPILFSDGIDCE
FT                   KFFKWYFSTPVSSQASLSVGSTDFELWPYIKEAQSACNDV"
FT   CDS             5312..5839
FT                   /note="ORF NRB175"
FT                   /db_xref="SGD:S000003231"
FT                   /db_xref="UniProtKB/Swiss-Prot:P53054"
FT                   /protein_id="CAA64125.1"
FT                   /translation="MRNNVTELVNSIIGVQTPGSLPDTLSGAHSLQRRISYFDVNWISW
FT                   NWDNVNVDLNKEVKKSRPLLGEEDDQCMFGWFANNPGWKYYWSVTDNPDPGYKENYSDI
FT                   GDENAVHGELYFNTYGGLMASVMTTKMVLNAKRQLVVIDTIVVKAICDYVMKYWKKKVN
FT                   LTTISLYLMLKL"
FT   CDS             complement(6290..6652)
FT                   /note="ORF NRF120"
FT                   /note="member of the serpauperine family (PAU1)"
FT                   /db_xref="GOA:P53055"
FT                   /db_xref="InterPro:IPR000992"
FT                   /db_xref="SGD:S000000505"
FT                   /db_xref="SGD:S000000775"
FT                   /db_xref="SGD:S000001038"
FT                   /db_xref="SGD:S000001438"
FT                   /db_xref="SGD:S000001874"
FT                   /db_xref="SGD:S000002142"
FT                   /db_xref="SGD:S000002950"
FT                   /db_xref="SGD:S000003230"
FT                   /db_xref="SGD:S000003526"
FT                   /db_xref="SGD:S000003759"
FT                   /db_xref="SGD:S000003987"
FT                   /db_xref="SGD:S000004453"
FT                   /db_xref="SGD:S000005359"
FT                   /db_xref="SGD:S000005521"
FT                   /db_xref="UniProtKB/Swiss-Prot:P53055"
FT                   /protein_id="CAA64126.1"
FT                   /translation="MVKLTSIAAGVAAIAATASATTTLAQSDERVNLVELGVYVSDIRA
FT                   HLAQYYMFQAAHPTETYPVEVAEAVFNYGDFTTMLTGIAPDQVTRMITGVPWYSSRLKP
FT                   AISSALSKDGIYTIAN"
FT   CDS             6860..7090
FT                   /note="ORF NRB76"
FT                   /db_xref="SGD:S000003229"
FT                   /db_xref="UniProtKB/Swiss-Prot:P53056"
FT                   /protein_id="CAA64127.1"
FT                   /translation="MEMLLFLNESYIFHRLRMWSIVLWHSCVFVCAECGNANYRVPRCL
FT                   IKPFSVPVTFPFSVKKNIRILDLDPRTEAYC"
FT   CDS             8470..8967
FT                   /note="ORF NRA165"
FT                   /db_xref="GOA:P53057"
FT                   /db_xref="InterPro:IPR001461"
FT                   /db_xref="InterPro:IPR009007"
FT                   /db_xref="SGD:S000003228"
FT                   /db_xref="UniProtKB/Swiss-Prot:P53057"
FT                   /protein_id="CAA64128.1"
FT                   /translation="MQLFSILSLLSSLMCSLTVLGSSASSYVKFPVQKFADIINIGTQD
FT                   VSTVFKRNEVLNTTVINGIGVYVVKMEIGTPPQTVYLQLDTGSSDMIVNNADIAYCKSM
FT                   SDGSDYASTDNYELTATFTGPRSTTTSPELITLSALIGVNSMQETHLLLRITRLSSMTY
FT                   TY"
FT   CDS             11110..11730
FT                   /note="NRA206"
FT                   /db_xref="GOA:P53058"
FT                   /db_xref="SGD:S000003227"
FT                   /db_xref="SGD:S000005914"
FT                   /db_xref="UniProtKB/Swiss-Prot:P53058"
FT                   /protein_id="CAA64129.1"
FT                   /translation="MSFLSIFTFFSVLISVATTVRFDLTNVTCKGLHGPHCGTYVMEVV
FT                   GQNGTFLGQSTFVGADVLTESAGDAWARYLGQETRFLPKLTTIASNETKNFSPLIFTTN
FT                   INTCNPQSIGDAMVPFANTVTGEIEYNSWADTADNASFITGLANQLFNSTDYGVQVASC
FT                   YPNFASVILSTPAVNIFGKDDTLPDYCTAIQLKAVCPPEAGFD"
FT   CDS             complement(12481..14157)
FT                   /note="ORF NRD558"
FT                   /db_xref="GOA:P53059"
FT                   /db_xref="SGD:S000003226"
FT                   /db_xref="UniProtKB/Swiss-Prot:P53059"
FT                   /protein_id="CAA64130.1"
FT                   /translation="MRRKNRLFILVVLLGIVLVVYYSQLNSLDLVEPVQSSSSGNGGCW
FT                   SYYEGLTPGWLNDFYDVNQITPNPAKDVIELVTRIKIFFNCLQQVDGHNIQRLRDIEKK
FT                   LFPYINFEKLETDESAFWHTTTRWNGEVYHASMLEFDPKNHQFLRSKPINFDTGLSFWE
FT                   NWLHTVTQSGSKGIVISASDVQLNETIRLLKVLRFIKNDYPIQIVHNADLSQDSMKSII
FT                   KYARSLDTAEYPAQELWFLNVHSLLNPKYSKKFTTYSNKWLALTFSSFEIPILMDSDTV
FT                   PFVSIEKFYELEEFQKTGVLFFKDRVISDDLFESSELKILREIVYGCIGLDLEDESKIH
FT                   EQVEDPVVAQVLENMFIKKYKHHLESGLVILHKGKHLFSMLTSIALQFSPIAEYFHGDK
FT                   DFFWLGELLSNNRFTFHPVDASNIGQLGNVVSKESTGEFYQICSVQLSHTDRDGSLLWL
FT                   NGGLNICKKTSWEYDYEHRQRLNDMFQNADELREYYASPVKLEGIIIPDTSISGWINSG
FT                   ECFLFNYCTLFKEGEFGKLIKFKEDEKLRLSQIVDIWNKDI"
FT   CDS             14910..16307
FT                   /gene="ADH4"
FT                   /note="ORF NRC465"
FT                   /note="EMBL:SCADH4;X05992"
FT                   /note="PIR:DEBY4;S07614"
FT                   /db_xref="GOA:P10127"
FT                   /db_xref="InterPro:IPR001670"
FT                   /db_xref="SGD:S000003225"
FT                   /db_xref="UniProtKB/Swiss-Prot:P10127"
FT                   /protein_id="CAA64131.1"
FT                   /translation="MLGITYAVNSTKQLIFCCLKYLTLLGYILLSNRKKGQRTNMYKRV
FT                   ISISGLLKTGVKRFSSVYCKTTINNKFTFATTNSQIRKMSSVTGFYIPPISFFGEGALE
FT                   ETADYIKNKDYKKALIVTDPGIAAIGLSGRVQKMLEERDLNVAIYDKTQPNPNIANVTA
FT                   GLKVLKEQNSEIVVSIGGGSAHDNAKAIALLATNGGEIGDYEGVNQSKKAALPLFAINT
FT                   TAGTASEMTRFTIISNEEKKIKMAIIDNNVTPAVAVNDPSTMFGLPPALTAATGLDALT
FT                   HCIEAYVSTASNPITDACALKGIDLINESLVAAYKDGKDKKARTDMCYAEYLAGMAFNN
FT                   ASLGYVHALAHQLGGFYHLPHGVCNAVLLPHVQEANMQCPKAKKRLGEIALHFGASQED
FT                   PEETIKALHVLNRTMNIPRNLKELGVKTEDFEILAEHAMHDACHLTNPVQFTKEQVVAI
FT                   IKKAYEY"
FT   CDS             20978..22108
FT                   /note="ORF NRC376"
FT                   /note="EMBL:SCFZF1;X67787"
FT                   /note="PIR:DEBY4;S07614"
FT                   /db_xref="GOA:P32804"
FT                   /db_xref="InterPro:IPR003689"
FT                   /db_xref="InterPro:IPR004698"
FT                   /db_xref="SGD:S000003224"
FT                   /db_xref="UniProtKB/Swiss-Prot:P32804"
FT                   /protein_id="CAA64132.1"
FT                   /translation="MSNVTTPWWKQWDPSEVTLADKTPDDVWKTCVLQGVYFGGNEYNG
FT                   NLGARISSVFVILFVSTFFTMFPLISTKVKRLRIPLYVYLFAKYFGSGVIVATAFIHLM
FT                   DPAYGAIGGTTCVGQTGNWGLYSWCPAIMLTSLTFTFLTDLFSSVWVERKYGLSHDHTH
FT                   DEIKDTVVRNTAAVSSENDNENGTANGSHDTKNGVEYYEDSDATSMDVVQSFQAQFYAF
FT                   LILEFGVIFHSVMIGLNLGSVGDEFSSLYPVLVFHQSFEGLGIGARLSAIEFPRSKRWW
FT                   PWALCVAYGLTTPICVAIGLGVRTRYVSGSYTALVISGVLDAISAGILLYTGLVELLAR
FT                   DFIFNPQRTKDLRELSFNVICTLFGAGIMALIGKWA"
FT   CDS             22304..23203
FT                   /gene="FZF1 alternate name SUL1"
FT                   /note="ORF NCR299"
FT                   /note="EMBL:SCSUL1;X78104"
FT                   /note="EMBL:SCFZF1;X67787"
FT                   /note="PIR:S45596;S45596"
FT                   /db_xref="GOA:P32805"
FT                   /db_xref="InterPro:IPR007087"
FT                   /db_xref="SGD:S000003223"
FT                   /db_xref="UniProtKB/Swiss-Prot:P32805"
FT                   /protein_id="CAA64133.1"
FT                   /translation="MTDIGRTKSRNYKCSFDGCEKVYNRPSLLQQHQNSHTNQKPYHCD
FT                   EPGCGKKFIRPCHLRVHKWTHSQIKPKACTLCQKRFVTNQQLRRHLNSHERKSKLASRI
FT                   DRKHEGVNANVKAELNGKEGGFDPKLPSGSPMCGEEFSQGHLPGYDDMQVLQCPYKSCQ
FT                   KVTSFNDDLINHMLQHHIASKLVVPSGDPSLKESLPTSEKSSSTDTTSIPQLSFSTTGT
FT                   SSSESVDSTTAQTPTDPESYWSDNRCKHSDCQELSPFASVFDLIDHYDHTHAFIPETLV
FT                   KYSYIHLYKPSVWDLFEY"
FT   CDS             23935..25395
FT                   /gene="HXK2 alternate name HEX1;SCI2;HKB"
FT                   /note="ORF NRB486"
FT                   /note="EMBL:SCHKB;X03483"
FT                   /note="PIR:KIBYHB;B23523"
FT                   /db_xref="GOA:P04807"
FT                   /db_xref="InterPro:IPR001312"
FT                   /db_xref="PDB:1IG8"
FT                   /db_xref="PDB:2YHX"
FT                   /db_xref="SGD:S000001949"
FT                   /db_xref="SGD:S000003222"
FT                   /db_xref="UniProtKB/Swiss-Prot:P04807"
FT                   /protein_id="CAA64134.1"
FT                   /translation="MVHLGPKKPQARKGSMADVPKELMQQIENFEKIFTVPTETLQAVT
FT                   KHFISELEKGLSKKGGNIPMIPGWVMDFPTGKESGDFLAIDLGGTNLRVVLVKLGGDRT
FT                   FDTTQSKYRLPDAMRTTQNPDELWEFIADSLKAFIDEQFPQGISEPIPLGFTFSFPASQ
FT                   NKINEGILQRWTKGFDIPNIENHDVVPMLQKQITKRNIPIEVVALINDTTGTLVASYYT
FT                   DPETKMGVIFGTGVNGAYYDVCSDIEKLQGKLSDDIPPSAPMAINCEYGSFDNEHVVLP
FT                   RTKYDITIDEESPRPGQQTFEKMSSGYYLGEILRLALMDMYKQGFIFKNQDLSKFDKPF
FT                   VMDTSYPARIEEDPFENLEDTDDLFQNEFGINTTVQERKLIRRLSELIGARAARLSVCG
FT                   IAAICQKRGYKTGHIAADGSVYNRYPGFKEKAANALKDIYGWTQTSLDDYPIKIVPAED
FT                   GSGAGAAVIAALAQKRIAEGKSVGIIGA"
FT   CDS             complement(25718..27484)
FT                   /gene="RTG2"
FT                   /note="ORF NRF588"
FT                   /note="EMBL:SCRTG2X;M97691"
FT                   /note="PIR:B44344;B44344"
FT                   /db_xref="GOA:P32608"
FT                   /db_xref="InterPro:IPR003695"
FT                   /db_xref="SGD:S000003221"
FT                   /db_xref="UniProtKB/Swiss-Prot:P32608"
FT                   /protein_id="CAA64135.1"
FT                   /translation="MSTLSDSDTETEVVSRNLCGIVDIGSNGIRFSISSKAAHHARIMP
FT                   CVFKDRVGLSLYEVQYNTHTNAKCPIPRDIIKEVCSAMKRFKLICDDFGVPETSVRVIA
FT                   TEATRDAINADEFVNAVYGSTGWKVEILGQEDETRVGIYGVVSSFNTVRGLYLDVAGGS
FT                   TQLSWVISSHGEVKQSSKPVSLPYGAGTLLRRMRTDDNRALFYEIKEAYKDAIEKIGIP
FT                   QEMIDDAKKEGGFDLWTRGGGLRGMGHLLLYQSEGYPIQTIINGYACTYEEFSSMSDYL
FT                   FLKQKIPGSSKEHKIFKVSDRRALQLPAVGLFMSAVFEAIPQIKAVHFSEGGVREGSLY
FT                   SLLPKEIRAQDPLLIASRPYAPLLTEKYLYLLRTSIPQEDIPEIVNERIAPALCNLAFV
FT                   HASYPKELQPTAALHVATRGIIAGCHGLSHRARALIGIALCSRWGGNIPESEEKYSQEL
FT                   EQVVLREGDKAEALRIVWWTKYIGTIMYVICGVHPGGNIRDNVFDFHVSKRSEVETSLK
FT                   ELIIDDANTTKVKEESTRKNRGYEVVVRISKDDLKTSASVRSRIITLQKKVRKLSRGSV
FT                   ERVKIGVQFYEE"
FT   CDS             complement(27921..31061)
FT                   /gene="HFM1"
FT                   /note="ORF NRE1041"
FT                   /note="EMBL:SC22156;U22156"
FT                   /db_xref="GOA:P51979"
FT                   /db_xref="UniProtKB/Swiss-Prot:P51979"
FT                   /protein_id="CAA64136.1"
FT                   /translation="MQSEAFPSIYESNENCIISSPTGSGKTVLFELAILRLIKETNSDT
FT                   NNTKIIYIAPTKSLCYEMYKNWFPSFVNLSVGMLTSDTSFLETEKAKKCNIIITTPEKW
FT                   DLLTRRWSDYSRLFELVKLVLVDEIHTIKEKRGASLEVILTRMNTMCQNIRFVALSATV
FT                   PNIEDLALWLKTNNELPANILSFDESYRQVQLTKFVYGYSFNCKNDFQKDAIYNSKLIE
FT                   IIEKHADNRPVLIFCPTRASTISTAKFLLNNHIFSKSKKRCNHNPSDKILNECMQQGIA
FT                   FHHAGISLEDRTAVEKEFLAGSINILCSTSTLAVGVNLPAYLVIIKGTKSWNSSEIQEY
FT                   SDLDVLQMIGRAGRPQFETHGCAVIMTDSKMKQTYENLIHGTDVLESSLHLNLIEHLAA
FT                   ETSLETVYSIETAVNWLRNTFFYVRFGKNPAAYQEVNRYVSFHSVEDSQINQFCQYLLD
FT                   TLVKVKIIDISNGEYKSTAYGNAMTRHYISFESMKQFINAKKFLSLQGILNLLATSEEF
FT                   SVMRVRHNEKKLFKEINLSPLLKYPFLTEKKQSQIIDRVSQKVSLLIQYELGGLEFPSY
FT                   EGASKLHQTLVQDKFLVFRHCFRLLKCMVDTFIEKSDGTSLKNTLFLLRSLNGHCWENT
FT                   PMVLRQLKTIGLVSVRRLIRHGITNLEEMGHLSDTQIEYYLNLKIGNGIKIKNDISLLP
FT                   CLNIRTKLENCKIENEELWLTFKVEISATFKSSIWHGQHLSLDIETEKSSGELIDFRRL
FT                   QVNKLQSPRGFRISAKISPKLEKIEFSIHCQEIAGLGKTIVYSTDHLASQFSAKTPNIR
FT                   KDLNSLEKCLFYESSSDGEVGKTSRVSHKDGLEESLSSDDSILDYLNERKKSSKAVESA
FT                   AVIHPEAHSSSHFSNGRQVRSNGNYECFHSCKDKTQCRHLCCKEGIPVKYIKEKGPSSI
FT                   KPVSKPDQIRQPLLAKNINTTPHLEKRLNSKPKQWQEENTDIATVHTLPSKIYNLSQQM
FT                   SSMEAGEQVLKSGPENCPEIIPIDLESSDSYSSNTAASSISDPNGDLDFLGSDIEFE"
FT   CDS             31898..32635
FT                   /note="ORF NRC245"
FT                   /db_xref="GOA:P53060"
FT                   /db_xref="UniProtKB/Swiss-Prot:P53060"
FT                   /protein_id="CAA64137.1"
FT                   /translation="MESKMSEEEAHKTVEVDDVGVQLDEGDEEDLLEYDDELVEEQPSD
FT                   ARIRNVAETLMKSELPKVTVEYKDTTFLLFTSDDKNESNNPIICENAALYQRPMGEFME
FT                   SIRKFMGNRFGRLAFATKELVLQLKSLDLTLFEDNVYNNHISFSDVYTIFKILKERSES
FT                   NFETDIPTHLAIELSTRPRFVSRYNALVELTESSATLKNIKPFSNDETHPLIVDDNDQY
FT                   THQNTSEVIVMDIDDDVGEDSED"
FT   CDS             33098..35212
FT                   /note="ORF NRC704"
FT                   /db_xref="GOA:P53061"
FT                   /db_xref="SGD:S000003218"
FT                   /db_xref="UniProtKB/Swiss-Prot:P53061"
FT                   /protein_id="CAA64138.1"
FT                   /translation="MIIERWEVKLSKCNQNVGGYSVLSGNLKENIKLGRRAQKYLKELR
FT                   NLQLKPLKIGGYENCGTINGEEYFLEVIHITSGRQKIDVAVGKTWNVTNIENDNKEELQ
FT                   YELFKEKLKVGKQDMLFFSWMKSLSVQLNAPLHQKMTEHGLADDNTRLEWFNIPLLRRS
FT                   QYRKKVPYPSLRQMSSVLEVQCSTLTEEKLNFCVGFSDKPLSEWKPQIFEQTYNRYRLQ
FT                   RISPEKSFKYKSRCSKYNFKTSSQSWVVKVPEHDQQLNTFEKRYDELFDAQFNKLEFFK
FT                   IRMKKLKKNKPIEKKNYKIWCLEKEDLKDLVWDPLKRICNHSRYAIFEHVTINREAYSI
FT                   KPLRLTFQKLDSGSLDLIDNQKKTFGSIKLAMSMPDVKKTENQSIEESERHDETAIETQ
FT                   EFDENDCLSSKADINTSLAPQKRSFIDNELMSMLVTKKKIKKDKDVSDTGISSTSYLIN
FT                   SGTYANSHIEIPTSNSVYNGKEDCSFNNYSVKHSILEEDIENKCIAVNENKVIENQKVI
FT                   QSLCKNSHLDLIEQSYFGECDFIINHSTCVYKIQASRFMQLRNNGSLHYDKAVNDLLTE
FT                   FQRVIIIVEFSEIIQDVDPDLFWKIKLYLLNSRVDVFFIHETTDFFIDWMKYFIARWAF
FT                   SYNDEKEKNIANADILLDLGFNILLVRKIFQTYSLEEFFMAIIKEESKAVKMLTVSQMT
FT                   RLKKLLTLEW"
FT   CDS             35653..36762
FT                   /gene="PDE1"
FT                   /note="ORF NRB369"
FT                   /note="EMBL:SCPPR;M17781"
FT                   /note="PIR:ESBYPC;S05879"
FT                   /db_xref="GOA:P22434"
FT                   /db_xref="InterPro:IPR000396"
FT                   /db_xref="InterPro:IPR011563"
FT                   /db_xref="SGD:S000003217"
FT                   /db_xref="UniProtKB/Swiss-Prot:P22434"
FT                   /protein_id="CAA64139.1"
FT                   /translation="MVVFEITILGANGGPTEYGTQCFILKPARTEDPELIAVDGGAGMY
FT                   QLREMLVQGRNENEGDDELVPSFYEHDREPIEFFIDSKLNIQKGLSKSLLQSLKRQGEH
FT                   FESANTMKKTYEVFQGITDYYITHPHLDHISGLVVNSPSIYEQENSKKKTIWGLPHTID
FT                   VLQKHVFNDLIWPDLTAERSRKLKLKCLNPKEVQKCTIFPWDVIPFKVHHGIGVKTGAP
FT                   VYSTFYIFRDRKSKDCIIVCGDVEQDRRESEESLLEEFWSYVAENIPLVHLKGILVECS
FT                   CPLSSKPEQLYGHLSPIYLINELSNLNTLYNSSKGLSGLNVIVTHVKSTPAKRDPRLTI
FT                   LEELRFLAEERNLGDLRISIALEGHTLFL"
FT   CDS             36933..37526
FT                   /note="ORF NRA197"
FT                   /db_xref="GOA:P53062"
FT                   /db_xref="SGD:S000003216"
FT                   /db_xref="UniProtKB/Swiss-Prot:P53062"
FT                   /protein_id="CAA64140.1"
FT                   /translation="MELRSFSRQPDGILANPRLGREEVLEGEHPQDARLARQSIWLSPS
FT                   LIAEYIQLFFNFIIGTIGLSLAIKFILMIRNDVNLKLEHNVREELDKIATCKSRYFENQ
FT                   CEPHMRVPALEVRCNEWSKCMNKEIVSGSDYQWAKAWARTLAEVINAFFEAFSIRSFLF
FT                   ILISIIGIIFVTNTSFGSYRVYLNNKDTKSVRHA"
FT   CDS             complement(37617..38780)
FT                   /note="ORF NRE387"
FT                   /db_xref="GOA:P53063"
FT                   /db_xref="InterPro:IPR013961"
FT                   /db_xref="SGD:S000003215"
FT                   /db_xref="UniProtKB/Swiss-Prot:P53063"
FT                   /protein_id="CAA64141.1"
FT                   /translation="MGVSANLFVKQRGSTTALKQPKEIGFYSRTKDEEYLISDDTNLNY
FT                   YYLPDAELDRKLDLSSGFQKFKDYYKDFEDRCSLRGLLETIESSERHKGKKINADIITF
FT                   RGIARKLISCAFDSPSFNTVDLRIVSFNGQLFIKEVPEAVNAAKASSATEAGRNINQDL
FT                   NVFTGYKFETLATLSNPLQYTPREVIEKRTKRIVSHGDEYISVVRTGVGNCKLILGAEV
FT                   DCIFDFKENGRDNLKHYAELKCTQQVANISDTHKFERKLFRTWLQCFLVGIPRIIYGFK
FT                   DDHYVLKTVEEFSTEEVPVLLKNNNPQVGSACLEAIKWYGLLTEWLLKMIPRDEDPHSQ
FT                   IRAFKLVFENNHLRLSEIEESDEEYSGLIDGEHILSNGFKEWRKSLK"
FT   CDS             38975..>39409
FT                   /note="ORF NRC145"
FT                   /db_xref="GOA:P46655"
FT                   /db_xref="PDB:2HRA"
FT                   /db_xref="PDB:2HRK"
FT                   /db_xref="PDB:2HSM"
FT                   /db_xref="UniProtKB/Swiss-Prot:P46655"
FT                   /protein_id="CAA64142.1"
FT                   /translation="MTKLFSKVKESIEGIKMPSTLTINGKAPIVAYAELIAARIVNALA
FT                   PNSIAIKLVDDKKAPAAKLDDATEDVFNKITSKFAAIFDNGDKEQVAKWVNLAQKELVI
FT                   KNFAKLSQSLETLDSQLNLRTFILGGLKYSAADVACWGALR"
FT   LTR             863..1135
FT                   /note="Ty5-LTR"
FT   LTR             1080..1135
FT                   /note="Ty5-LTR remnant"
XX
SQ   Sequence 39411 BP; 12278 A; 7476 C; 7023 G; 12634 T; 0 other;
     ccacacccac acacaccaca cccacaccca cacactaccc taacactacc ctaaccctat        60
     tctaacccag atcaaccttc tcacaactta ccctccatta ccctacctcc ccactcgtta       120
     ccctgttcca ttccattcta caactccaac caccatccat ctctctactt actactacca       180
     tccaccgccc atcataaccg ttaccctcca attaccatat ccaactccac taccattacc       240
     ctactattac cctaccatcc accatgtcct actcactgta ctgttgttct accctccata       300
     ttgaaacgtt aacaaataat cgtaaataat acacatacac ttaccctacc actctaatcc       360
     cactaccaca tgccatagcc atcctcactt gtattctgat cggtcatacg cacacggatg       420
     ctacagtata taccactctc aaacttaccc tactctcaca ctccaatcca tggcccatct       480
     ctctcactaa atcagtacta aatgcaccca catcattatt cacggcactt gcctcagcgg       540
     tctataccct gtgccattta cccataaagc ccatcattat ccacatttta atatttatat       600
     cttattcggc ggccccaaat attgtataac tgctcttaat gcatacgtta taccactttt       660
     acgccatata cttaccactt aatttatata cacttatgtc aatattacag aaaaatcacc       720
     actaaaatca cctaaacata aaaatatttt acctttcaac tttacgaaat aaacactttg       780
     acttgaagta tgagcactac catgacgtca ttaatgtaaa agttccttaa tattgctatt       840
     ttcttgaacg gatgacattt catgttgaat gtggtaaccc aatagcatga tatgagtaat       900
     gtttagacaa agaaaacata tagtagtaaa cgtttaatcc ggtagtactt aagaaaccat       960
     agtttctatg tgcaaaaaca gtacctaggt aattattaca tttacataac atatagaaag      1020
     gtccaataaa cttactacat tatgatatat aaactagatc gtaattcata acgtcaacac      1080
     ccaaaagcat gatacgagta atgtttagta ttttttcagt attgtttcaa taatgcggta      1140
     cagaggaata gcatacagta acaaaatctt caatcaactt gcaaccaaaa aaccctcagt      1200
     ttatatgtac aaaatagtaa ttccatgtat cttccttttt ggtgagatca aagttttcaa      1260
     tagttgaacc taaaacaaaa ttccacgata tgaggagact atcacccttc ctagagataa      1320
     aattttaatt agcccgtcta ctttctcaaa aattacagag gaattttctg aagctattaa      1380
     tagaagtaag cagctaaagg cttaatatga aaaaacatac agcccgagcc tgtactaaat      1440
     gtaacgtaaa attttgccta cgatcttgtt atatgccatg aaaagtttct tttgatgatg      1500
     acaattgttt taagctagct tttttcggta atactacgaa aattctaaaa tgatcagtgt      1560
     ggataccgaa ctataaatag ggatgaatgg agtgaacttc aagtactgat gcatttgcta      1620
     ataactagtt gctcacattt aaagttcttt gtcgtttaca ggcaactgtt taccaacgct      1680
     ggacagataa acatctagaa gtcaatgttt ggccagtaat gcttttctag ttttttttcc      1740
     agtaattatg atggcattac gtataaacgg agagtgatga cgttttaaaa gtcatttgat      1800
     catacgcagt ttttcacttc gaaatttata gcgctaattc tctcctatag gggcatatat      1860
     gaagacagtt agactgaaca aaagaattta aatcttgcgt atgtaggtct ttagagtttc      1920
     acagttgatg tttatcgctg caaatttata taaatcatca tactgatact gctataatat      1980
     ttccttgttc aatattaagt gatggcttta agatagtcgt tttttacaga gctttaggca      2040
     agaatctgag tttgagcgtt acaaaggtgg ttgcttcagg catgtgcctg ggaaatgaac      2100
     ctaattgtat ctttatattt ttaaatagtt atgaggagtg agatgcatta ttatatttat      2160
     tatagagtga atattgagga ctgcctcgga tttaacgcac cgcaagcgta tattctacta      2220
     tttaattata cccacttttg taatataatt attaatacaa tatgttttta ttaaagagag      2280
     tgcagagaat cgaaaaccta aagagtagat ttgaaatcta atagtttcac cttaaaacac      2340
     atctcctttt aaaacttatt gtaattattc attagaattt ttatatttaa ttaatctatc      2400
     ctttttacta atgaaaaatt ctttaaataa aaaaatctat acatccacta gaaagtatat      2460
     ataaatttgg ggtacctgca atctttattt attttatttg aagtaatagg aattatttat      2520
     attattgtga taagaagtag tattctatta ttataactat attaataaaa aattttattt      2580
     tctattgaaa accaattttt tacaccaaat atcagacacg ctttgtctat ttctatcata      2640
     tagcgactgt gatataatgc gcgcgtgttt tgaacggcat ttttttagcc tgcgaatatg      2700
     gatagatgat ggttttagga aacatatgaa cgaactacca ggacgtaata actgcaaaat      2760
     aatgtctcct gaactacatc gccataggca tggatggagc caaatttgaa aatactgtag      2820
     cttttttacc atctgaaata tttgattgct acaattccac gctacccaag aatgtattcc      2880
     gaagttttgt tacctggtcc tgctatgaga aattcaattc cttagaattc cgcacttggc      2940
     tattaatgtg gttaccactc attattgcgt ggaaaatacg tggtaaaaga cactatctcg      3000
     ttatcgttac tgctcttatg tttgaagtgc tgtatttctt atggacatat tcgtacatat      3060
     tccgagaacg caccttagga aagcaagttt ctcaatttgc taaagagatc attacaaata      3120
     ctccgggtat agacactgaa gactgggaac gtgttgcagt aaatttcaat tcttatttat      3180
     atgaaaataa actttggaat actgagtact ttttttttga tggttccagc tgccaagaag      3240
     cgttcagaaa gatgcttctt gagccatttt ccttgaaaaa aaatgacttt gctaatgcca      3300
     aggtacctga cggatctgtt tgttacactg aaaaagcttt gcaggtttat tttacacaga      3360
     tagagagaaa atggcactgg attaattctg aaggattttt acacaataaa accacacaga      3420
     gtgttcaatt ttcgaaacat ggttacggtt ccaaacttct ctgggctttc aaggaagtga      3480
     caataatgaa ttcacgcttt gcgttcttca gtattgctta cttaaacggt ctccttacta      3540
     taccaagact aagaaattca ctgcatatcc tctatgtatg tgcagttctt tcatctatga      3600
     taattgaata tttaataggg atcgacaaat tcaggttcaa atcaatgaat ctgatacata      3660
     aactacagtt cttgtcatat attacatgtg gacacgagaa gtctgatgca actaattggt      3720
     ctcaaattgc gaagaggacg aatacttaca tgtttgagca gaaaatttgg aattcgccaa      3780
     tactgttctc agatggtatt gattgtgaaa agttttttaa atggtatttc agtacccctg      3840
     tatcttcgca agcgtctttg tcagttggtt ccactgattt tgaactctgg ccatatataa      3900
     aagaagcaca atcagcttgc aatgatgtgt aattggtaaa gatattgata tactattctt      3960
     aaagaccaaa aaaaagctgt taataaccca agtttaaaca ttagtagata atgcaatatt      4020
     tgatgaagtc tgtagagtgc cactatacat cgtaataaaa ttacacagta cgtgcttgta      4080
     cggtcgccat atcatgagat tacttgaagc ttccttgaag ctcataccgt aaccagtttt      4140
     atacgttttt ctttcctcat accaacatcc tttaacgttt gttgagagaa aatgcggtag      4200
     tttttgtaaa acaccttacg tgaaagatat tattactatt tcaagaccaa acgcgtaacg      4260
     aatgtatatt ctagtactgc gttaaggtat gagttaccca taataaattt tattactatt      4320
     aacattttct tggagtactt cgttttctta cttgatgtac gttgctatac agtacgcatt      4380
     aaagaaattg cagctatcgt cgtgtttggt tcatacggtt gagttaatat ttcaaaataa      4440
     tgtccgtaat aattattacc gacatctgtc tgccttttat taacatatct cgcgttcaac      4500
     ctgtgcgttg cttatcgctt gagtaggggc gaaacacctg ttgaaatctt acggtgaact      4560
     ttcactattt aaaggactgc ttttctccaa gagtttttat tatacagaaa tatcgtagca      4620
     gtatcccagc gggagataga tccttttcag aaattaacgt tcatgactgg tcaagagaaa      4680
     ataggcgcta agcgttttca gatctgctgg agagtttgga gacgcaatat actgctattc      4740
     atctttgtat ttgctgtttc cttttattat tttcgttcaa gagatgcaga agctatagtt      4800
     aatactacgg taattgcctc acctgtggtg actagttatc taatgaaagg caaaactact      4860
     attgggcgtt agcaggtggt gccagtggat tttcaattac gctagcagga ctctccggtg      4920
     catacgccgc taacaaatgt acagcagatt caggtagtac tcatgctgga ctggagctgt      4980
     agttacattg gtagcagatg ctttagatgg agttgctacc actgctgata cgattgctgg      5040
     ggcagcggct ttgacggcag cagcggcaaa aaagatctac tggatatatt gctactattg      5100
     ctggattaga cttccattct tcaagtcctc gtaatttcac tgcaatcaac accaccatgc      5160
     aaacagttgg tcttgtatta tcaggagcat ttgactatat gaacacatag aaggctaatg      5220
     gcttagaaaa gagagaacaa aataacacag ttacagaaat gcagcatgtt tgatatttta      5280
     gtagtcagtt gggtcttcat gtgccactca catgcgtaat aatgtgactg aattggtcaa      5340
     cagtataata ggtgttcaaa cacctggatc gctaccagat actctttctg gggcacattc      5400
     attgcagaga cgcataagct attttgacgt caattggata tcatggaatt gggacaatgt      5460
     aaatgttgat cttaataaag aggtaaaaaa aagtaggccc ctccttgggg aggaggacga      5520
     tcaatgcatg ttcggttggt tcgcaaataa tccagggtgg aaatattact ggtcggtaac      5580
     tgataatcct gatccaggat ataaagagaa ttactctgac attggagatg aaaatgctgt      5640
     ccacggtgaa ttatatttta acacatatgg ggggttgatg gcttctgtaa tgacaacaaa      5700
     gatggtgctc aatgcgaaga gacagcttgt ggttattgat acaattgtgg taaaggccat      5760
     ctgcgattat gttatgaaat attggaaaaa aaaggttaac cttactacga tatcattata      5820
     tttgatgtta aagttataaa gccagacatt ttcaatcttt ctttaaatca atgaaagaag      5880
     atgcgcaaat attgaaagca ttgactacta agacttagga aaaagcttct gttgacgatt      5940
     tataatgtta tatcaaataa ttaaatttat ttcctagatt tttgaattgt gagagacatc      6000
     cctagcatga ttttttttca catatacttt caattttaat agaaatggag ccgtcaaatt      6060
     taacttattt tctattttta taattgaaaa ttttatttat tcatctattc tacattttat      6120
     tttggtgttg ggattttttt ccggcttaaa tatatggtca gatcttttat ttatattaca      6180
     cttatctaca atttgtattt atatcatcaa aaagagcttt ttatttctat attttatttt      6240
     tcgttactta ccaatgtcta tagaatttcg ttcgtaaagg cgtttgtctc tagtttgcga      6300
     tagtgtagat accgtccttg gatagagcac tggagatggc tggctttaat ctgctggagt      6360
     accatggaac accggtgatc attctggtca cttggtctgg ggcaatacca gtcaacatgg      6420
     tggtgaagtc accgtagttg aaaacggctt cagcaacttc aactgggtag gtttccgttg      6480
     ggtgggcggc ttggaacatg tagtattgag ccaagtgagc tctgatatca gagacgtaga      6540
     cacctaattc aaccaaattg actctttcgt cagactgagc tagagtggtg gttgcggaag      6600
     cagtagcagc gatggcagcg acaccagcgg cgattgaagt taatttgacc attgtatttg      6660
     ttttgttttt tagtgctggt ataagcttaa caggaaagaa agaaataaag atatattctc      6720
     aaaagcatac agttgaagca gctctattta tacccgttcc tctatcagtc atcactactt      6780
     aaacgattcg ttaacagatg ctcatttagc acctcacata tcctccatat ctcatctttc      6840
     acacaatctc attatcacta tggagatgct cttgtttctg aacgaatcat acatctttca      6900
     tagacttcgt atgtggagta ttgtattatg gcactcatgt gtattcgtat gcgcagaatg      6960
     tgggaatgcc aattataggg tgccgaggtg ccttataaaa cccttttctg tgcctgtgac      7020
     atttcctttt tcggtcaaaa agaatatccg aattttagat ttggaccctc gtacagaagc      7080
     ttattgttaa agcccatact cagtctgttc taaacggctt ccatgcaaga aatatttcta      7140
     tctcttgaat tcgtacaaca ttaaacgtgt gttgggagtc gtatactgtt ggcgtctgca      7200
     aatttgtgaa ttctccgcga atgccttggt gcaattacgt aattgtagcc gctgaaggcg      7260
     gatggttttg agagaagttg atgttcaaag aatcgtgtat gataaaaaaa aaaaattgta      7320
     accaattcgt aaatactgaa actctttgca gtaagaaatc tttcattccc agagagaacg      7380
     cggaaatatt cagcctaagt ctctccaaat tgatttcttt cattttggta gcgaaagact      7440
     tagtatcaac ctcaaaaagc tgaaattttt gtagatatat gtgcagatga catgaagtat      7500
     ccagctcttt tgtgaatatg gaagcaagtt tctttcaaat tattatcgac ttttcctctg      7560
     ccccttttac cttataactt taggaaacac taccctattc atactcaact aaaaaagtag      7620
     tacgttttct tctttgagag gtatggtgca aaccagtgca atctgattcc agattgccct      7680
     cacgtgaggc ttcagtaaat ctcgatccct ctacatatta tattatctcc tacttggcaa      7740
     aatagatgtg gctttagttg atgaaaattt accacgtcaa ctatttatgt cctttctaca      7800
     ataaaccccg acctactatc ctctatgttg tttttaacat accatacgag cgtcatatgt      7860
     cttttggttc actggggaag accatcactg ttgaacgttt gttgaaaagt tcgagatgat      7920
     gaagattgca taacaaaatg taaagttata tttagaaact ataacggttc aagacattca      7980
     acactataac atagcttggc tggcttgaac aaaaagagga agaagcaaaa gcaagagtaa      8040
     aaagcttctc atatatttct ggcattgttg atcacccagt gcaagcccaa tttcgcctgt      8100
     gcttttctta aattgtttct gacaacaccg aggttttcgc tgcagaaaag gacatatggt      8160
     ggtaatttgt ataaggggtt aagggtccaa aaatttgcta ccctatcgct cactatagca      8220
     aaatatctcg agagatatcc gaggagttaa aactgactag acctgttgcg taaacctcat      8280
     gcaagcagta ctcttcgagg atttaagctt tggaactgct ttcaaagttg agagtatata      8340
     aggtgttatg atcttggaat aaggtttttc atcgttcttc cttgttctct attttcattg      8400
     gttgatcagt tgttaaattt tgtctctttc gaaaataagg atatttgaag acaacgcaac      8460
     gctatcaata tgcaattgtt ttccatcctc tctttgttgt catcattgat gtgttcattg      8520
     accgttttag ggtcttccgc aagttcctat gttaagtttc ctgttcaaaa gtttgctgat      8580
     attataaata taggcacaca ggatgtttct accgtcttca aaagaaatga ggttcttaac      8640
     accacagtga taaatggaat aggagtgtat gttgtcaaga tggaaatcgg aacgcctcca      8700
     caaacggtgt acctacagtt agatactggc tcttcagata tgattgtgaa taatgctgac      8760
     attgcctatt gcaaatcgat gtctgacgga tctgactacg cttcaactga taattacgaa      8820
     ctcacggcaa cattcactgg gcctcgttct actaccacct caccagagct tataacactg      8880
     tccgctctta taggggtaaa ttcaatgcaa gaaactcatc tacttttaag aataacgcga      8940
     ctttcttcaa tgacatatac gtattagaag gaacctatgg tacggacgtt gtctctttaa      9000
     agaatttttc accttaaata atatcattgt tggcctatta aattataaaa tgggcaatcc      9060
     aagtggcatt ttaggcatat cccttcccct tgcagaattt acagataatg ttgaaaatgc      9120
     atttgctttg aacagaaaac tcttcgtata tgagaattct aatggcattt gaaagacaag      9180
     gaaagatcga aaagaagata tcgtattcct tatttttgaa tggacctaat gtacactttg      9240
     ggagcatctt attcggtgca gtcgataaaa gtaagtacgc agaagagctc tgcacacatc      9300
     ctatgcgtca agcttataat acccttgatt caaactcaag aataattatc acagtacaga      9360
     gtgttgcaat tttggacggc aaacttgtat ggtaaaagtg ttgtagatat tcagtttcca      9420
     gtgccattaa attccggtac atattctgtt tacctacaaa atttgtaaat tggattatta      9480
     agagttttaa tgagaaatat aactctgatg atcaaggcta cacttttgac tgctcaaaag      9540
     tcaggatact ttactgtgtg tcgactttga atgacttaat atattgagtt tatctccgat      9600
     agtgtcccag cgccacccct tgctccagga tactccagta tgtcggtata taagtctgat      9660
     agctccatcg ggacaggaga ttttattaat gtcagctgaa cctcgtattt agaattttca      9720
     cagtacacat cattgcttgt cactggaatg caaggcgatg gtgttagttc tttcccaagt      9780
     gggggcagtt ctagcaaaat ggcccctaaa aaaaaaaagg ttgcatatat cgttcttctt      9840
     tttcctattc attgctgtgc ttcacatctt attttctttc ataattaaag aagagccata      9900
     tagtttcgca ttgtactact gtgtaagaca gcaagttttt tgatagacaa caagaggagc      9960
     tatagtggta atacgagtta tactcatagg tcctatctcc tattcgtatt tattacattg     10020
     tactctgcgg cttcatatac aaataataaa cttataagga aggattatac atttttggaa     10080
     atattatcgc tacgatagat aatgtgatga gttttacaag tgtaaaattc ttccgtagag     10140
     tttgagggca atcgcaaaat ttccggagag tccttgataa attattacag tgaaaacgta     10200
     tatgaaatgt tccaattgag atatctcgct tatattaata cttcttcttt cttttaccat     10260
     atattttcta attggccgct cagctatagc gatctttaca tgtatacttt gaagtttttt     10320
     taaacagtgc acccgtgcat catacctcat gcaaggtacc tttttttctc aaaggtattg     10380
     tcttctattg aagtggcact atggcatgat gaaccctgag catttccgaa ttcaacagaa     10440
     ccaaattgtc cagaattaaa tctgtccgtc atgaaataag caactttttt tcaatcaagt     10500
     gaagtgagtt ttgcagtatc ttaccattat tttgacctat tggccgcatg tttgtgcttt     10560
     gacttcgaga accatgttaa agcttacttg tacgacaacc aatgaagtac attacggcag     10620
     ttttttggac tgggtcaaaa aaagtgttgc ataatcaaat caggaacaca ttaaaatgtt     10680
     ataaaatttg tcttagtatg acctgagtgg ttattcatta cgtactactg tcaaaatatt     10740
     cggatctttc ctaaacgggc ttttgaatta gtgttgcttc tattcctgga atggaaggta     10800
     gtaatttcat gcattctcgc ttttcggact tttaacaata aattaaaaac aatgatactt     10860
     tcatcaacta cctatacacc ctgcgggtca attatttttt ttttcgaata accgctgagg     10920
     ttggaaatat agaaacatat tccagatctg tattttcagt tgctagaaaa aggttaatat     10980
     tatcattaag gttttcagca tataacaggt ataattgata tataagcatc gtaattttca     11040
     ttcaaaatgg agagctactg cttctgatag attgtacaat ctcaagaaat caagaacaac     11100
     aaccatacca tgagtttcct aagcattttt acttttttca gcgtccttat ttctgttgca     11160
     acaaccgtca gatttgattt gactaacgtt acctgtaagg gcctacatgg acctcattgt     11220
     ggtacctacg ttatggaagt cgttggtcaa aacggtacat ttttgggtca atctacgttt     11280
     gttggcgccg acgtcttgac tgaaagcgct ggtgatgctt gggcaagata tttgggccag     11340
     gaaacaagat tcctcccaaa gttgactact attgctagta acgagacaaa gaacttttct     11400
     ccactcatct tcaccaccaa tatcaacact tgtaaccctc aatccattgg tgacgctatg     11460
     gttccttttg ctaacactgt tactggtgaa attgaatata actcttgggc agacactgct     11520
     gataacgctt ccttcataac cggtttagct aaccaattgt tcaactctac cgattatggc     11580
     gttcaagttg cttcctgtta cccaaatttt gcttctgtta tcttaagcac cccagctgtg     11640
     aatattttcg gtaaggatga cacattacca gattattgta ccgccattca gctaaaggcc     11700
     gtttgtccac cagaagctgg ttttgattaa tcttttctca catcctcact tatagatatg     11760
     ttttgattat tttcgttata gacaaaaatc ttttgagaaa gccatgcgga agttattttt     11820
     aactgtaaag tacaatcgat ttcctttagg catttctact ttcttctgac cctgatttaa     11880
     aattttcgag ttctttttgt tacgatgcgt tatttattgt cgatttatta catataattc     11940
     tttataatat aaaagtgcaa tacagtgcat ctagatatgg attttcaaaa ttttgcagaa     12000
     tatgatcggt ttgcctacaa gataaaagta aattattcac aatttccaac atttaaaagt     12060
     ggcgatcgca tagtaaaagc gttaagaatg atgctacatc ccacatgaga gtggttcgat     12120
     tatgctgaat ttcaacacca attcaatata ctttaattta aacagacatt tatgatgcca     12180
     gagacataaa ggatccgaaa ggttttagga acaccttagt ggaaaatcat tttagcgtgg     12240
     ccgggagtac cagatttttc atagttccct attgcaatca atttggattt ttgctggcgt     12300
     tgcatcatgg ctatgttatc caatgcatgc caagagtgat ttacttaaag agtaacttcg     12360
     ttacaaaaca ttacgttata cttcagtgcg ataatttttc agatatcaaa aattatacta     12420
     cattatacaa caaaagcgtg taggtttacc tattgcttat aagactagaa caactcttgg     12480
     tcaaatatct ttattccata tgtcgactat ttgtgaaagc cggagctttt cgtcttcttt     12540
     aaatttgatc aactttccaa actcaccttc cttgaataat gtgcaataat tgaacaaaaa     12600
     acactctcct gagttaatcc atcctgatat actagtatct ggtattataa tcccttcaag     12660
     ttttactggt gatgcataat attcacgtaa ttcatctgca ttttggaaca tatcatttag     12720
     tctctgtcta tgctcataat cgtattccca tgaagttttt ttacaaatat taaggccccc     12780
     gtttagccat agcaaggacc cgtccctgtc tgtatgagat agttgcacag aacaaatctg     12840
     gtaaaactca ccggtactct cttttgaaac tacattgccc aactgaccaa tgtttgatgc     12900
     atccacagga tggaacgtaa agcgattgtt cgaaagtaat tcgcccagcc aaaaaaagtc     12960
     cttatcacca tgaaaatatt ctgcaattgg agaaaattgt aaagctattg aagtaagcat     13020
     actgaagaga tgctttcctt tatgcaatat taccaggccg ctttccaaat gatgtttata     13080
     tttctttata aacatgtttt ccagaacctg tgcaaccact ggatcctcta cttgctcatg     13140
     tatcttggat tcatcctcta aatcaagccc aatacaccca tagacaattt cccttagaat     13200
     ttttaattca gaggattcaa atagatcatc tgatattacc cgatctttaa agaatagaac     13260
     tccagtcttt tgaaattcct ctaattcata aaatttttct attgaaacaa agggcactgt     13320
     atctgagtcc attagaatag gaatttcaaa ggatgagaag gtcaatgcta accacttgtt     13380
     ggaataggtg gtaaattttt tcgaatattt cgggtttagc agactatgta catttaaaaa     13440
     ccataattct tgagcaggat attcagcggt gtctagactt ctcgcatatt tgataataga     13500
     tttcatggaa tcttgactca gatctgcatt atgaacaatc tgtataggat aatcattttt     13560
     gatgaacctc aacactttca ataagcgtat ggtttcattc aactgcacgt cagaagcact     13620
     aataactatg cctttcgaac cactttgagt cacagtgtgc aaccaattct cccaaaaaga     13680
     tagccctgta tcgaaattga tgggcttaga acgaaggaat tgatggtttt tggggtcaaa     13740
     ttccaacata gacgcatggt aaacctcgcc attccatctc gtagttgtgt gccagaaggc     13800
     actttcatca gtttctaatt tttcaaagtt aatatacgga aagagcttct tttcaatatc     13860
     cctcaaacgc tgaatattat gcccatcaac ctgctgcaag caattaaaaa aaatcttaat     13920
     cctcgtaacc agttcaatca catcttttgc aggattcggg gttatttgat ttacgtcgta     13980
     gaagtcattc aaccacccag gcgtaagacc ttcatagtaa ctccagcagc caccattgcc     14040
     actgctgcta ctttgaactg gttctaccaa atctaacgaa ttcaactgag agtaatatac     14100
     tactaacaca attcccagta gtacaactaa tataaacagt cgattttttc ttctcatatt     14160
     cgataaatac tattggggct acttttgtcc tgtcactgcg gatttgcaaa cactcatgcg     14220
     aatattttac tcaattgaga gatttgctgt ctccccccac ttcgatggtc cccaccccta     14280
     aagtaaagga aagaagaatt agcactgttt tagttccagg tacttctttc tttctttacc     14340
     ggtattgtgt ggctcatcaa aacttcgtct cgggaaaatg aaaaatgtaa acaagaattt     14400
     ccgtttcaaa gagttgccta aggcccacta ataatgtact tattatttac aattcggaga     14460
     acgctgctga tagaaatcaa tcaagaagtc ccttagtctt tgtgtgttta cgccatattg     14520
     cttagtttcg tagtgcgtta cagttctatc gtgtgaaaat ttttttctaa tgcatcagct     14580
     gttatgcgca ctacttgaaa ggttatcgag cgtttgtaaa aagtagaagt acttaaatga     14640
     accttcacgg ttaagcaacc agtataattg aggctgctga tttgaaattg cgttttgtgt     14700
     tcagaaggat ccccggaggc cttcaatgag cttccatttt attttctcca aggaggccat     14760
     tttttgtagt gtgatgttga catggttata actgttagca gtgtttgtga tgatggctgt     14820
     agtatcaccg cagtggatta gctatgaaaa aaaaaaaaaa gaactagttt ttagttcgcg     14880
     catcacgagg tacgtgttta atatgtcaga tgcttgggat cacgtatgcc gttaactcta     14940
     caaagcaatt gatattttgc tgcctcaaat atctcacact actaggatat attcttttat     15000
     caaacaggaa aaaagggcag cgtaccaaca tgtataaaag ggttattagc atttctggtt     15060
     tattaaagac tggagtcaaa cgtttttctt ctgtctattg caaaacaacc atcaacaaca     15120
     agtttacatt tgcaacaact aatagtcaaa taagaaaaat gtcttccgtt actgggtttt     15180
     acattccacc aatctctttc tttggtgaag gtgctttaga agaaaccgct gattacatca     15240
     aaaacaagga ttacaaaaag gctttgatcg ttactgatcc tggtattgca gctattggtc     15300
     tctccggtag agtccaaaag atgttggaag aacgtgactt aaacgttgct atctatgaca     15360
     aaactcaacc aaacccaaat attgccaatg tcacagctgg tttgaaggtt ttgaaggaac     15420
     aaaactctga aattgttgtt tccattggtg gtggttctgc tcacgacaat gctaaggcca     15480
     ttgctttatt ggctactaac ggtggggaaa tcggagacta tgaaggtgtc aatcaatcta     15540
     agaaggctgc tttaccacta tttgccatca acactactgc tggtactgct tccgaaatga     15600
     ccagattcac tattatctct aatgaagaaa agaaaatcaa gatggctatc attgacaaca     15660
     acgtcactcc agctgttgct gtcaacgatc catctaccat gtttggtttg ccacctgctt     15720
     tgactgctgc tactggtcta gatgctttga ctcactgtat cgaagcttat gtttccaccg     15780
     cctctaaccc aatcaccgat gcctgtgctt tgaagggtat tgatttgatc aatgaaagct     15840
     tagtcgctgc atacaaagac ggtaaagaca agaaggccag aactgacatg tgttacgctg     15900
     aatacttggc aggtatggct ttcaacaatg cttctctagg ttatgttcat gcccttgctc     15960
     atcaacttgg tggtttctac cacttgcctc atggtgtttg taacgctgtc ttgttgcctc     16020
     atgttcaaga ggccaacatg caatgtccaa aggccaagaa gagattaggt gaaattgctt     16080
     tgcatttcgg tgcttctcaa gaagatccag aagaaaccat caaggctttg cacgttttaa     16140
     acagaaccat gaacattcca agaaacttga aagaattagg tgttaaaacc gaagattttg     16200
     aaattttggc tgaacacgcc atgcatgatg cctgccattt gactaaccca gttcaattca     16260
     ccaaagaaca agtggttgcc attatcaaga aagcctatga atattaaaaa aatcgaacga     16320
     actcataaac gtcaattatg cgtgtgcctt atttatttag ttgtgcgtac agtataatgc     16380
     acttatttat ttaccaatca aatgattttt ttaacttttc acgatctata taattacgtt     16440
     aatttcgagt atataacaat gaaaatatat atctacgttg ttttaaattg aaaaaagaag     16500
     aacggaagtt ctattaatga gccgagaccg gtacgtttgt tgaaaatagt ttggacttaa     16560
     ttactgacat actgttggct ttgaagcatt taagactgaa aaatagtcat gcaaaagtca     16620
     tgctttaata tggtgggttt cagttggatg caagaaataa aatgaaattc gaaggccttt     16680
     tgcaattaaa caaggcatcg tcaaccagac aatgtcgaaa attttgagtc aatctaaatc     16740
     aatccaccgc cacactgaat tctgtcaatg atattgtctt cctttttttg gtttgatatc     16800
     tctaattttc aacctgttat aagcaacgtc aatccgatta ctttcgtgtg tcattcacat     16860
     gcgcatattt ttttattcgt tttatgatat agctgtcttt attataacct cgaaacacaa     16920
     cggcaatgta accttaccag ccgcattatt acaaggagcc cactttattt tcaattgcta     16980
     tcgctacatc gcaaatgcta cagcaccccc atcagacctt gaagtatata tatatttaat     17040
     aataaataca ttattggaat ggctagtaaa ttttgacata aacatgattt ccgaacgaat     17100
     taaaatacag ttgatttagg agaaagtatc agtacattgc taaaaatttt aagcaaatgt     17160
     taagtgaaaa aggcttatca ttcagatgag cttaagaata tactttttgc gttattcaag     17220
     agcgatgatt attactgaac tactgtgacg atatcagcag catgcctgat aaataaatct     17280
     gtacattcgt ggaaagtagt atgtactttt caaatatttc taagagctaa tgatatttat     17340
     ttgatattta tatcgacaaa tgaatctttt tcatagaagc cgttatgaag actccaaata     17400
     gcaatactca aaatatacta taagatctcc gaccaggtac ataatacatg acacagcaca     17460
     aataaccgac caactgacaa tagtagaaag tagcggacgg tgtcacacgg ttttctcgtc     17520
     cacatcactg gaagtaagca atctcttggc cagctttcgg tgatccaaat attatatcag     17580
     accagtttca ttattctcgg aagtagagtc gaatatttcc tattgtatag tgctaatgct     17640
     atcaatgttt attatataca acgtacaata gtattattct ctaagatcgt tgagttgctc     17700
     atagagaaat ccaaaatatt gtgcacaata aattatatta tctttttgag acgatgaaat     17760
     cttaaaaatt gtcagcaaat aaatgtttat ttatcgaata ctaggtcgaa acattttttt     17820
     tgtttattca aaatgatcat gtaccttctt ctcgcgaaag ttttaattaa aatttactga     17880
     tagtttttta atgatgaact tctataacta aaccataata atgaaaatta caggtaatat     17940
     ttatatcaca agaaacggcc cctcttttct gtttttatat agtaaccatt aagaatagtt     18000
     ggctaatcta ctatgaaagt tcctaattaa aaaaaattca tgaagagtta atcaacgttc     18060
     cagtaccaaa tttattctat gttctccttg gaagatgaac ttgccgcagt agatcataga     18120
     acctcatttt caacgttttc caaagaaata ctttttttat ttaactgaca aatattaata     18180
     cagtctttat atcatcgata tgactaaagt acatcggaat tgcccagcag tagagctcgt     18240
     gatcgaatag aaaaacgagg gccttcagta gctcgtagac ataggttaag atcatggatc     18300
     ctgcattaaa aaattcacat agcgctagaa ttttgttagc gcatccgcct gtttttcttt     18360
     caaatgtaaa attttaaata cgatcattcc tttggatact cagcaatagt gcgcaccagt     18420
     taagaactgt ttttatggtt aaacatgtct taatataatg tgcatacttc aatgcaccca     18480
     aaatgtatat gttcagacag tttgtcaata gagtaataat cattcaaaca aaaccgtaaa     18540
     tttgaatgtt agatgtagct gtaaagaaac ttgctagatc taaatattaa tagaaaaact     18600
     ctaactatca attaaacgac atcttacatt tcaatttcat aaaaattatt cttttggcta     18660
     gtttatatca tatagctttc cgtaaaacca gtaacaagca atacactaaa ttgtccatgt     18720
     tttaactacc atttccttct aatttttttc ctttcttagc tgatttaatt catttatttg     18780
     ctgtcgtttg catttactga ctaaaaaaag tgtaaaatat gggaagcgca aattgaaaag     18840
     tcgggttgcg aaattacctg ccaaaaatcc acctcgttaa tatctaacaa gattcaacgc     18900
     ctgttgacaa aagaaactcg tcagtctctc agtttacttc tatgtttaac atatttgcta     18960
     tgatccactc tagattctgc ccagccctca acttcacgcc cacgttgaga gtacattcag     19020
     tacgttgaaa atacattcag tcacacccgc agcacagcaa gtcgtttcat ctaagctatt     19080
     ttgatcgtta gaatatccac acctcacaag tatcgacaat ttagatgtgt attgggtttt     19140
     gtctacgcaa ataccattag tttcacacaa gatgccatca gcgctactgt aaatagattg     19200
     ttcctctgtt atcgtgcgaa tggaactaga aaaccaataa tcattgaata atatatgtga     19260
     cagtgacagg ccaccagaat aaagctaata tctagagggg tatttcttct tgagtgaaga     19320
     agaaatatgc tacttccaaa ttttaggacg acaaatcctc ataatatgaa ttaggcaaat     19380
     tacagaatga agggggttga gaagtcccac agcacatcgc tccttcgcta agagctccac     19440
     tgctaaaaca gaaaaaaaaa gtattaatca attgtactac catgttcttt gttactaaac     19500
     gcgcctattt ttttcgagag cctttacgag agtcaatcaa gcattctccc gcatacttcg     19560
     ctaagaaaaa agtgatcttt aattgggccc ttcatctatc atttttgctt aagtggcgta     19620
     acttatttta tcatttcctc tccctgccat cctctttatt tttgttctgt atcacagcag     19680
     ttaattcagt ttccattcaa agtatgccac ggataacttg atgcttcaag aagaaaaatt     19740
     atttggccta aaacttgctg tttcttcaca atttttctaa atgctctccg attcccggat     19800
     tgcagatgtt tcactgctcc acattatatc ctttgtgtcc accttgataa tcgatacttt     19860
     aaagattatt ttgtgggagg agagccttag aaagaatacg cttgttttaa gaaggaaaac     19920
     aagcggcacc aatcttcaat tggtatttta aaatctatta gacgtcaaat cccggttaga     19980
     cttgagatag atgtacctgg agagaaaatc tataataaaa aaaaaaatac tttcaggtca     20040
     gatatttctt tttttgtccc taataaaaag aaatggtatt ctgccaaaca ccaaagtgcc     20100
     aaataagcat tattttacat agtacgaaat ggaaattacg tcaattatcg acattatgac     20160
     ataaaattgg atttaacaag atctctgaat ctgatatgct tctttcatta gggtggaaat     20220
     aacagcattt gagagaagca attgccaagc ttctatgaaa attttctaga aggcaagagt     20280
     atttcagact ttcctaatat gaaaggacaa attgacacta atgtctgatt atggccaatt     20340
     cctgcggtaa attacacggc gattacggcg acatgagctc acattcatca ctctatggga     20400
     caaatgtttc caaactgggc gcaacaaaca cctgatgtga ctcctaccct ttggacaatg     20460
     cagatccacg ctacggcaaa ttagtcaaat gcactagaac atggcgcaag tacttattgt     20520
     gacctttggg gtaccgttac cgtcagtttt cttcagctaa ggcgcgcgcg ccagataact     20580
     aaaaaaaaat atagttgctg cttaaaaaac aatacacccg tactctcttg cctgtaaaaa     20640
     cctcgaagga ccaaagatac cctcaaggtt ctcatctgtg cggtattctt caaattacaa     20700
     tgacatttcc caaaattatc agatgtgctc aggtatcttc tctccaatga gatgagacag     20760
     atgaacatat ttgaccttga aggtcatgga aagtaggttg agagcaaatg tgtagaacga     20820
     aattaagaaa aaaagaaatt acgcacggca ttagctcgat gacttagtta taaatagagg     20880
     cctggtatcg gctgtcatga tctcatctct tccctattta caaaaaaact gcaagtatag     20940
     acaataaaac aacagcacaa atatcaaaaa aggaattatg agcaacgtta ctacgccgtg     21000
     gtggaaacaa tgggaccctt ctgaagttac acttgccgat aaaacccctg atgatgtgtg     21060
     gaagacctgt gttttgcaag gtgtttactt tggtggaaac gagtacaatg gtaacttagg     21120
     tgccagaata tcttccgtct ttgttattct tttcgtgagt acttttttca ccatgttccc     21180
     attaatctca acaaaagtga aaagattgag aattcctcta tatgtttacc ttttcgcaaa     21240
     gtattttggt tccggtgtta ttgttgcaac cgcatttatc cacttaatgg accctgctta     21300
     tggtgcgatt ggtggtacca cttgtgtagg acaaaccggt aactggggtc tttattcatg     21360
     gtgtcctgcc attatgctaa cgagtttgac cttcactttc cttactgatc tattcagtag     21420
     cgtctgggtt gaaagaaagt atggtctttc ccatgaccat acccacgatg aaattaaaga     21480
     cactgttgtg agaaacactg cagctgtttc aagtgagaat gacaatgaga atggtactgc     21540
     aaatggatct catgacacca agaacggagt agagtattat gaagattcag acgctacatc     21600
     catggatgtt gttcaatcat ttcaagcaca attttatgcc tttttaattt tagaattcgg     21660
     tgtgattttc cactccgtta tgatcggtct aaacctggga agtgttggtg atgagttctc     21720
     ctccctatac cctgtcttag tgttccatca atcatttgaa ggtttaggta ttggtgcaag     21780
     attgtcagcc attgaattcc ctagatcaaa gagatggtgg ccatgggccc tatgtgttgc     21840
     gtatgggtta accacaccaa tctgtgtggc catcggtttg ggtgttcgta ccagatacgt     21900
     cagcggttct tacactgcgc ttgttatctc tggtgttttg gatgccattt ctgctggtat     21960
     cttattgtac actggtttgg ttgaactact agcaagagac tttatattca atcctcaaag     22020
     aacaaaggat ctaagagaat tgtccttcaa cgttatatgc actcttttcg gtgctggtat     22080
     catggctttg atcggtaagt gggcttaaac caaagcgaaa ttctgcatgt tccatataga     22140
     ttctatttca tattttatag ttatttattc tttagtaata gcaaaaaaac agtaataatt     22200
     tttctttaac agtctcggac aataaatacg ctaaagaaga tgaaaatgac aacttttacg     22260
     ctggtgtgca caagtggtac cagaatacgt ggccaccaaa acaatgacgg atatagggag     22320
     aaccaagtct agaaattaca aatgttcttt tgacggttgt gagaaagtct acaacagacc     22380
     tagtttgctt cagcaacacc aaaattcgca taccaatcaa aagccgtatc attgtgatga     22440
     gccgggatgt ggcaaaaaat ttataagacc gtgccatcta cgagttcaca aatggactca     22500
     ttcacaaatc aagcccaaag cgtgcacatt atgtcaaaaa agatttgtca caaatcagca     22560
     attaagaagg catttaaata gtcatgaaag aaaaagcaag cttgcatcaa gaattgaccg     22620
     taaacacgaa ggagtgaatg cgaatgtgaa agcagaactc aatggcaagg agggaggttt     22680
     tgacccaaaa ttaccttccg gctctccaat gtgtggtgaa gaattctcgc aaggtcattt     22740
     gcctggatat gatgacatgc aagtgctaca atgcccatac aaatcatgtc aaaaagttac     22800
     cagcttcaat gacgatctaa taaatcatat gttgcaacat catatagcaa gtaagcttgt     22860
     tgtaccatct ggagatccat ctctgaagga atcgcttcca acctctgaga aatccagcag     22920
     caccgacact acatccattc cacaactttc atttagcact actgggacaa gcagtagtga     22980
     aagcgttgat agcactacgg cacaaacccc aactgatcca gagagttact ggtcggataa     23040
     ccggtgcaaa catagtgatt gtcaagagct tagtccattc gcatctgtat ttgatctcat     23100
     tgaccactat gaccacacgc acgccttcat tcctgagacg ctggtaaagt acagctacat     23160
     tcatttatat aagcctagcg tctgggattt attcgaatac tgaacgccat agaagagcaa     23220
     tttccgtcct ctactcatgt gattcgaact atgaaacaaa gaaaaggcaa gagtaaatag     23280
     cgtgatacct attacgtatt acgtatacat cctattattc ttgaaaaaaa gtgcggggct     23340
     ccagagctcc acattggtga ccccagagta tactgctctt tctaatgcct tttccatcat     23400
     gttactacga gttttctgaa cctcctcgca cattggtacc tagaaatggc tatcatgccg     23460
     gacggcaccg ggcaataaac cggacggcac aaaaaaatcg aagaaaagag atttcttttt     23520
     ctcgcgggca gtttttccgg tcgatcgaca ttcgtacggt actttctctg tttcagggac     23580
     atcatgttgt aaaagaaaaa gacagtttag gtaatcgttc ttttctttct gaaaaatttt     23640
     ccacgacgac gacgacgacc acgaaacacc tttgattgcg agatccacga aattacctcc     23700
     tgctgaggcg agcttgcaaa tatcgtgtcc aattccgtga tgtctctttg ttgcaccttc     23760
     gccactgtct tatctacaaa actataaaaa agagtaatcc taccccatat ctaaaaaaaa     23820
     ttccttaact tttataactt aacttcaaag tttcttaata ttttttcgct ttttctttga     23880
     aaaggttgta ggaatataat tctccacaca taataagtac gctaattaaa taaaatggtt     23940
     catttaggtc caaaaaaacc acaagccaga aagggttcca tggccgatgt gccaaaggaa     24000
     ttgatgcaac aaattgagaa ttttgaaaaa attttcactg ttccaactga aactttacaa     24060
     gccgttacca agcacttcat ttccgaattg gaaaagggtt tgtccaagaa gggtggtaac     24120
     attccaatga ttccaggttg ggttatggat ttcccaactg gtaaggaatc cggtgatttc     24180
     ttggccattg atttgggtgg taccaacttg agagttgtct tagtcaagtt gggcggtgac     24240
     cgtacctttg acaccactca atctaagtac agattaccag atgctatgag aactactcaa     24300
     aatccagacg aattgtggga atttattgcc gactctttga aagcttttat tgatgagcaa     24360
     ttcccacaag gtatctctga gccaattcca ttgggtttca ccttttcttt cccagcttct     24420
     caaaacaaaa tcaatgaagg tatcttgcaa agatggacta aaggttttga tattccaaac     24480
     attgaaaacc acgatgttgt tccaatgttg caaaagcaaa tcactaagag gaatatccca     24540
     attgaagttg ttgctttgat aaacgacact accggtactt tggttgcttc ttactacact     24600
     gacccagaaa ctaagatggg tgttatcttc ggtactggtg tcaatggtgc ttactacgat     24660
     gtttgttccg atatcgaaaa gctacaagga aaactatctg atgacattcc accatctgct     24720
     ccaatggcca tcaactgtga atacggttcc ttcgataatg aacatgtcgt tttgccaaga     24780
     actaaatacg atatcaccat tgatgaagaa tctccaagac caggccaaca aacctttgaa     24840
     aaaatgtctt ctggttacta cttaggtgaa attttgcgtt tggccttgat ggacatgtac     24900
     aaacaaggtt tcatcttcaa gaaccaagac ttgtctaagt tcgacaagcc tttcgtcatg     24960
     gacacttctt acccagccag aatcgaggaa gatccattcg agaacctaga agataccgat     25020
     gacttgttcc aaaatgagtt cggtatcaac actactgttc aagaacgtaa attgatcaga     25080
     cgtttatctg aattgattgg tgctagagct gctagattgt ccgtttgtgg tattgctgct     25140
     atctgtcaaa agagaggtta caagaccggt cacatcgctg cagacggttc cgtttacaac     25200
     agatacccag gtttcaaaga aaaggctgcc aatgctttga aggacattta cggctggact     25260
     caaacctcac tagacgacta cccaatcaag attgttcctg ctgaagatgg ttccggtgct     25320
     ggtgccgctg ttattgctgc tttggcccaa aaaagaattg ctgaaggtaa gtccgttggt     25380
     atcatcggtg cttaaactta atttgtaaat taagtttgaa caacaagaag gtgccctttt     25440
     tctacttatg tgaacatgtt ttctatgatc tttttttttc ttacttttac aactgtgata     25500
     ttgtataaac tttgttagaa attcacggga tttattcgtg acgataaata tttatataga     25560
     caaagaatat gacgatttat gaaatctaca tgattttagt ttcttttaac aattgctcgt     25620
     ttttttctct tgcttaattt taaatttttt tggtagtaaa agatgcttat ataaggattt     25680
     cgtatttatt gttcaagtat ttaaagacta gatgtcttta ttcttcataa aattgcacgc     25740
     caattttaac cctctctaca cttcctctag atagcttgcg tactttcttt tgtagcgtga     25800
     taattctgga acgaacggaa gcacttgttt taagatcgtc cttactaatt ctcacaacca     25860
     cttcataccc gcgattttta cgcgtggatt cttcttttac ctttgtagtg tttgcatcat     25920
     caatgattaa ttcttttaaa ctggtctcca cctcactacg cttagaaaca tggaaatcaa     25980
     atacgttatc tctgatatta ccacctggat gaacaccgca aatcacatac ataatcgtac     26040
     caatatactt cgtccaccat acaattctca atgcttcagc tttatcacct tcgcgtagaa     26100
     ctacttgttc taattcttgg gagtattttt cttcagattc cggaatgttg ccgccccatc     26160
     tactacatag agcaattcct atcagcgctc tagctctgtg agataatcca tgacagccgg     26220
     ctattatccc tcttgtagca acatgtaatg cagctgttgg ttgtaactcc tttggataag     26280
     aggcatgaac aaatgctaag ttacataaag caggagcaat cctttcgttt actatttctg     26340
     gtatatcttc ttgtgggatt gatgttctca atagatatag atatttttca gtaagtaatg     26400
     gagcataagg acgggacgca attagcaatg gatcttgtgc acgaatttct tttggaagaa     26460
     gagaataaag tgaaccctct cgaacaccac cctcactaaa atgtacagct ttgatctggg     26520
     gaatcgcttc aaaaacagca ctcatgaaca aaccaacggc aggaagttgt aaagcccttc     26580
     tatcagaaac cttaaatatt ttatgctctt ttgaagaacc tggtattttt tgttttagga     26640
     atagataatc tgacatagac gagaattctt cataagtgca agcatatccg ttaattattg     26700
     tttggatggg ataaccttcc gactggtaaa gaagcagatg tcccatacct cttaaaccac     26760
     ccccacgggt ccaaaggtca aatccacctt ctttcttggc gtcatcaatc atttcttgag     26820
     gtataccaat tttttcaatc gcatctttgt acgcttcttt aatctcataa aaaagtgccc     26880
     tattatcatc tgttctcatt cttctcaaaa gagttccagc tccatatggc aaagatacag     26940
     gtttgctgga ttgcttgact tctccgtgcg agcttattac ccatgataac tgagtactac     27000
     cacctgccac atctagatat agacctctta ctgtattaaa tgaggaaaca acaccatata     27060
     tgccgaccct agtttcatct tcctggccta atatttctac tttccagcca gtgctaccgt     27120
     aaacagcatt aacaaattca tccgcgttaa tagcatctcg cgtggcttct gttgcaatta     27180
     ctctgacact agtttcaggt acaccaaaat catcgcaaat taatttgaat ctcttcatgg     27240
     cagaacaaac ctcttttata atatctctgg gaatagggca ttttgcgttc gtatgtgtat     27300
     tatattgaac ttcgtataga gaaagaccaa ccctatcttt aaaaacacaa ggcataattc     27360
     ttgcatgatg tgcagccttg gaagatatac taaaacgaat accattagaa cctatgtcga     27420
     cgattccaca caagtttctc gacacgacct cagtctcggt atcactatcg ctaagtgttg     27480
     acatttgtgg cacgcctaca cttttcgttc aaaacaatcc ttagtaaagg acacttccaa     27540
     gagtgagttt cttttttaaa aggtacatat gaatgaatta ctaatctcac ttcgattctt     27600
     tcaattgatc taggaactcc gccggcaaag ttatcctatc tcggcattct gacccggatc     27660
     gcttatcgcg gtcatgtgac taataattga aatgataaat agcacgatat gtaacaatag     27720
     taatatatca attgacaatg tcatcttgtt ccctaataaa tagtaaaggt tccaattgtt     27780
     tcaccactgg ctgcatttta aaaacaaagc attataagta aactctcaca catgctaact     27840
     tctgttggga agcaatacaa ataacagaaa ggattggggt aatgaatatc agtaatgtct     27900
     attgttcccg gccatgccgc tcattcaaac tctatatcgg aacccaagaa atccagatca     27960
     ccattcggat cacttattga gctcgccgct gtattactag aataactatc ggatgattca     28020
     agatcaatag gaattatttc agggcagttt tcggggcctg attttaggac ttgttcaccc     28080
     gcttccatag acgacatctg ttgcgataga ttataaattt ttgaaggaag tgtatgaact     28140
     gtcgcaatat ctgtattttc ttcttgccac tgctttggtt tactattcag tcttttttcc     28200
     aggtgagggg ttgtgttgat attttttgca agcagtggct ggcgtatttg atcaggtttt     28260
     gatactggct tgattgagga gggtcctttt tcttttatat actttactgg aataccctct     28320
     ttacaacata aatgtctgca ttgcgttttg tctttgcagc tatgaaaaca ctcgtaattg     28380
     ccattagatc ttacttggcg gccattacta aaatgtgaag aagagtgtgc ctccgggtga     28440
     ataactgctg cagattcaac cgcctttgat gatttcttcc tttcattcaa ataatctagt     28500
     atactatcat ctgaggatag cgattcttct aatccatctt tatgggaaac cctagacgtt     28560
     ttccccactt ctccgtcact actgctttca tagaagaggc atttttctaa actatttaga     28620
     tctttcctta tatttggtgt cttcgcagag aactgtgatg ccaaatgatc agtggaatat     28680
     acgattgttt tgccgagtcc ggcgatttct tggcaatgaa ttgagaattc tattttttct     28740
     agttttggtg atatttttgc tgaaattcta aagccccttg gtgactgtag tttgttaact     28800
     tgcaatcttc taaagtcgat taactctcct gagcttttct cggtttcgat atctaatgag     28860
     aggtgctgac catgccaaat gctagacttg aatgttgcac taatctcaac tttaaatgtc     28920
     aaccacaact cttcattttc tattttgcaa ttttctagtt ttgttctaat attcagacaa     28980
     ggcaacaaag aaatgtcgtt tttaattttt atgccgtttc caatcttgag gttaagatag     29040
     tattcaatct gagtatctga caaatgcccc atttcttcta gattggtaat tccatgtcgt     29100
     attagccttc ttactgaaac tagtccaatt gttttcaatt gcctaagaac cattggcgtg     29160
     ttttcccagc agtgaccatt caggcttcgc agtaagaaca aagtattttt cagtgatgtt     29220
     ccatcacttt tttcaataaa tgtgtctacc atgcatttta gtaatctaaa acaatgtcta     29280
     aaaacgagga atttatcctg aacaagagtt tgatgtagtt tagaagcgcc ttcgtatgat     29340
     ggaaattcta acccacctaa ctcatattga atcaaaagag aaaccttttg actaaccctg     29400
     tcaattattt ggctctgttt cttctcggtt aaaaatggat atttcaaaag tggcgataaa     29460
     ttgatttctt tgaacaattt tttttcattg tgcctcaccc tcataactga aaactcttca     29520
     gaagtggcca gtaaatttag tatcccttgt aatgatagaa atttttttgc gttaatgaat     29580
     tgtttcatcg actcaaagga tatataatgt cgcgtcattg catttccgta cgctgtagat     29640
     ttgtactccc cattgctgat atcgattatt ttcactttta ctaaggtgtc aagcaaatac     29700
     tgacagaatt gatttatctg agagtcttca acggaatgaa aactaacgta tctgttcacc     29760
     tcttgatatg cagctggatt cttcccaaat ctaacgtaaa agaatgtgtt tcgtagccaa     29820
     tttactgcag tttcaattga atatacagtt tccaaagagg tttctgctgc taaatgctcg     29880
     atcaaattca aatgtaatga actttccaaa acgtcagttc catgaattaa gttttcatat     29940
     gtttgcttca ttttagagtc tgtcatgatt actgcgcacc cgtgagtttc aaattgaggt     30000
     cttcctgccc gcccaatcat ttgcagtaca tctaggtctg aatactcttg gatttcagaa     30060
     gagttccaac ttttggtgcc tttgataatg accaaatatg cgggaaggtt cacaccaaca     30120
     gctaacgttg aagttgaaca caatatatta attgaacctg caagaaattc tttctcaacg     30180
     gcagtacggt cttctaaaga aattccagca tgatggaaag cgataccttg ttgcatacat     30240
     tcatttaata ttttatcgga gggattatga ttacatcttt tcttactttt tgaaaaaata     30300
     tgattattta ataaaaattt tgctgttgat atagttgaag ccctagtcgg acaaaatatt     30360
     agtacgggac gattatcggc atgcttttca attatttcaa tcaatttgga attatatata     30420
     gcatcttttt ggaagtcatt tttgcaattg aaggagtacc cataaacaaa cttcgttaac     30480
     tgaacttgcc tgtacgattc gtcaaaagaa agaatatttg caggaagctc gttgttagtt     30540
     ttgagccaca atgctaggtc ttctatattt ggaactgttg cacttaaagc aacaaaccga     30600
     atgttttgac acattgtatt catccttgtc agaattactt ccaaagatgc tcctcttttc     30660
     tcctttatgg tatgaatctc atcaactagg acaagtttga ccaattcgaa taatcggctg     30720
     taatcggacc atcttcttgt taacaaatcc catttttctg gtgtcgtaat tattatgtta     30780
     cattttttag ccttttcagt ttccagaaaa gaggtatcac tagtaagcat accaacagaa     30840
     agattcacaa aggaaggaaa ccagttcttg tacatctcgt aacatagaga tttggttggc     30900
     gcgatgtata taattttggt gttattggta tcactatttg tttcctttat aagacgtaat     30960
     attgccaatt caaataatac agtcttgcct gatccggttg gtgaagaaat tatgcagttc     31020
     tcgttactct cataaatact aggaaaagcc tctgattgca ttttattaaa ttctgtaaat     31080
     ttaaaaaccc ctctgaatga atctggtaat atggtcgtgc tcaaacattt cttcgctgat     31140
     ttccttatcg tgaccttctt aggtttcttc gcctcttcat caggtgtctg ctctaaatcg     31200
     tgatcaaata atttactagt tacttgtgta tcatctgctg ttattgaaaa attatcgtct     31260
     ttgtcgaaga attgcagacc acggccctca aatatttcct ctgtttcatt ttcatcatca     31320
     caatcatcca gtaaactgtt ataagacaaa cctactttaa aacttggttg gcggctattt     31380
     ttcttatttc ttttaaatgt agcagactgg tcgttaaagt caatatctat aagtcctctg     31440
     aaattctagt ccagaaaaac cacttttggt tgcatttccg ctagataata aaagaaagag     31500
     gtaacaatgt tagtcaaaat actgttgttg tccgatatgg tgtaaactga taagggtgtt     31560
     gctaagcttc gttactacta tttggagagg gtctacttct ttttcctgta ccgaggcgat     31620
     caaactttgt tttcatcctt acgacgcctc ttaagttgtc aaatccacct tgaggtatca     31680
     atcattttca atgaaaggat ttcttgatag atgatactaa tagtcccgtt ttgtttataa     31740
     tccggggcaa agtctaaata cccgccgagc ctgcatccat tcgtggtaca tgatatgtta     31800
     aaactacaac aaggcataaa aaagggaagt atatatgatt aattatatat acgtaaagga     31860
     aaagatacgt agttaaagat tgtttttgtt ggtatcaatg gaatcaaaga tgagtgaaga     31920
     agaagcgcat aaaacagtgg aggtggatga cgtcggggtt caattggatg agggcgatga     31980
     agaagacctt ttggagtatg atgatgaact cgtggaggaa caaccatcgg acgcccgtat     32040
     acgcaacgtg gcagagactt taatgaaaag cgaattgccc aaagtcaccg tggaatataa     32100
     agatactaca tttctgttgt tcacgtcgga tgataagaac gaaagtaaca accccataat     32160
     atgtgaaaac gctgctcttt atcagcgacc catgggggaa ttcatggaat ccattcgtaa     32220
     atttatggga aatcgttttg gcaggttggc ttttgctacg aaggagttgg ttttacaact     32280
     gaaaagcctc gatttgacct tgttcgaaga taatgtctac aacaaccata tttcattcag     32340
     cgatgtttat actatattta aaatcctgaa ggaaagatcg gagtctaatt ttgaaactga     32400
     tataccgacg cacttggcta ttgaattaag tacaaggcca agatttgtct ctcggtacaa     32460
     cgccttggtt gaattaactg aaagctcagc tacgttgaaa aacataaagc cattttctaa     32520
     cgatgaaacg catcccttaa ttgtggatga caatgaccaa tatacacacc agaatacttc     32580
     agaagtcatt gtaatggaca tagatgatga cgtaggtgag gattctgaag actaaagtag     32640
     ccatgtttaa tcagcactga tcgtgggaaa tcctgatgtc caacggtgag tttctgattt     32700
     cccagtcacg gattcctttt gagaatcttc tcccgcgaat aaattattgg ctctgtgtaa     32760
     tatttaaggt cgccttcttt ttcgtttgta tagtcagcag ttaagtattc attaattttg     32820
     gatgatgcaa aggtccatat tcgatttctg atagcccttc cccctttttt gtagcgaatt     32880
     gtattattgt tttgtattgt tttttcgtca ttttcttcaa tttttttcaa gttttacttt     32940
     cggaagaatt gctgaaagta ttttctgtta ggatatgtaa aatacaagca taaaatatgt     33000
     ttcaggagaa gaaaatcact caatagtgcc acaccattgt taacgagctc gagtaattga     33060
     atcaatttag agaaatagat catattacaa aaatactatg attattgaac gttgggaagt     33120
     aaagttatct aaatgtaacc aaaatgtggg cggctattct gttctgtcag gaaacttaaa     33180
     agaaaacatc aaactgggaa gacgagcaca aaaatatttg aaagagctaa gaaatttgca     33240
     acttaaacca ctgaaaatcg gagggtatga aaactgcggc acgatcaatg gtgaagagta     33300
     ttttttggag gtaattcaca tcacctctgg aagacaaaaa atagatgtag ccgttggcaa     33360
     aacatggaat gtgactaaca ttgagaatga caacaaagaa gaactacagt atgagttatt     33420
     caaggaaaag ttaaaagtcg ggaaacagga catgttattt tttagctgga tgaaaagtct     33480
     ttcagttcaa ttaaatgctc ctcttcacca aaaaatgacg gaacacggtt tggcagacga     33540
     taacacgagg ttagagtggt tcaacatccc acttctcaga agaagtcaat acaggaaaaa     33600
     ggtaccatat ccgagtttaa gacaaatgtc ctctgtactg gaagtgcaat gcagcacact     33660
     aacggaggaa aagttgaact tctgcgttgg attttctgat aaacctttgt cagaatggaa     33720
     gccccaaatt tttgagcaaa cctacaatag ataccgttta caacggatct cacctgagaa     33780
     atctttcaaa tataagagta ggtgcagtaa gtacaatttc aagaccagtt cgcaaagctg     33840
     ggttgtgaaa gtcccagaac atgatcaaca gcttaatacg tttgaaaaac gttatgatga     33900
     actctttgat gctcaattta ataaactaga attttttaaa ataagaatga aaaaattgaa     33960
     aaagaataag ccaattgaga aaaagaacta taaaatatgg tgtctagaaa aagaagacct     34020
     aaaggatttg gtatgggatc ctctgaaaag aatttgcaat cattctaggt atgcaatatt     34080
     tgagcatgtt accataaata gggaggccta ttcgatcaaa ccattaaggt taacttttca     34140
     aaaattagat tccggctccc ttgacctgat cgataatcaa aaaaagacgt ttggtagtat     34200
     aaagcttgca atgagtatgc cagatgtaaa aaaaactgaa aatcagtcaa ttgaagaaag     34260
     tgaaagacac gatgaaactg ctattgaaac ccaagaattt gatgaaaatg attgtctttc     34320
     atctaaggcg gatattaata catcattagc tcctcaaaag agatctttca tcgataatga     34380
     actaatgtcc atgttagtca ccaaaaaaaa aataaagaag gacaaggatg ttagtgacac     34440
     cggtatatct tccacttcat acttgataaa ttctgggaca tatgcaaatt ctcatattga     34500
     aattcctacc tctaattcag tttacaatgg aaaggaagat tgctcattta ataactactc     34560
     agtaaagcat tcaatattgg aagaagatat tgagaataaa tgcatagccg taaatgaaaa     34620
     caaggtgatt gagaaccaaa aggtaattca gtcattatgt aaaaattccc atctagacct     34680
     tatcgaacaa tcttactttg gcgaatgcga tttcattata aaccattcaa catgtgtata     34740
     taaaattcag gcgagccgat ttatgcaact cagaaataac ggctcattgc attacgataa     34800
     agcggtaaac gatcttttaa ctgaatttca gagagtcatt ataattgtgg agttttctga     34860
     aataatacaa gacgttgatc ctgatctttt ctggaaaatc aaactttatt tattgaattc     34920
     acgtgttgat gtttttttca ttcatgagac tactgacttt tttattgatt ggatgaaata     34980
     tttcattgca agatgggcct tttcatataa cgatgagaaa gaaaaaaata ttgcaaatgc     35040
     cgatattctt ctagatttgg gatttaacat cctcttagta cggaaaattt tccagacata     35100
     tagtctcgaa gaatttttta tggcaataat aaaggaagaa agcaaagctg ttaaaatgct     35160
     tacggtttca caaatgactc gcctgaagaa gttattaacc ttagaatggt aaatccagca     35220
     aggatcgtta cccggtaaac tatttatact acgcctgcct ctttcgttct tcgactacat     35280
     gctacagtta gtaaattcaa ccaaggaaaa tgtatttatt aacatgaact agccacctaa     35340
     ttaaccctta ccttattttt tatacccttg gatcatcgga gtatctgtag atcatatgtt     35400
     aacgtatgta taatattaca tctgtcacaa taaacaaccc gaaaaaaata ccgcacggaa     35460
     aatgagttac tgattaagat gcactttttg gtgagggtgc gtgacttgaa actaaaaatt     35520
     accaatagtc aaaccctttc cattttcgag ggaagcaata tctgaaattt atatttttag     35580
     aaatttccaa gagaaagtgg cttttaacga ggttcttctt cttcatcccc ttttttacca     35640
     atattccttt ttatggttgt attcgaaata actatacttg gggccaatgg aggacccacc     35700
     gaatacggaa cacagtgttt tatacttaag cctgctagaa cagaggatcc agaattaata     35760
     gctgtagacg gtggtgcagg aatgtaccag ctacgggaga tgttggtcca agggcgaaat     35820
     gaaaatgaag gtgatgatga gcttgttcca agcttttatg aacatgatcg agagccaata     35880
     gagtttttta ttgattccaa actgaacata caaaagggat tatccaagtc cttgctacaa     35940
     tcattaaaga ggcagggaga gcattttgaa agcgccaata caatgaagaa aacttacgag     36000
     gttttccaag gaattaccga ctactacatt acccatcccc atctggacca tattagtggg     36060
     ctggtagtaa actccccctc aatatatgag caggaaaaca gtaaaaagaa aactatttgg     36120
     ggattaccgc atactattga cgttttgcaa aagcatgtct ttaatgactt aatatggcca     36180
     gatttaacgg cagaacgttc aagaaaattg aagctaaaat gcttgaatcc gaaggaagtt     36240
     caaaagtgca ctatctttcc ttgggatgta ataccgttca aagttcatca tgggataggc     36300
     gtcaagactg gcgcgccggt atacagcacc ttctatatct tcagagacag gaaaagcaaa     36360
     gactgtataa tagtttgcgg agatgttgag caggaccgca gagaatctga agaatctcta     36420
     cttgaagaat tttggtctta cgttgctgaa aatataccgc ttgtgcatct caagggtata     36480
     ttagtcgaat gttcatgccc attatcttcc aagcccgagc aattgtatgg tcatctatct     36540
     ccaatatatt taatcaacga attatccaat ttgaacactt tatacaacag tagtaaggga     36600
     ttaagcggtt tgaatgttat cgttactcac gttaagtcaa cacctgctaa aagagaccca     36660
     agactaacca tactcgaaga gttacgattt ttagctgagg agaggaactt aggagacttg     36720
     agaatatcta ttgcgctaga aggccacact ttgtttctat aatgtacaca acgtcaataa     36780
     cataatacta cgtagatgaa aagcggaaaa attcattacc cgggagcaag caaaatacta     36840
     gtagtaacta atgaaacttc tttccattat tattgatgag ttaacttatg tagactcatc     36900
     tttgaatccc ctatcccaac ataagtcccg gaatggaact ccgtagtttt tctagacagc     36960
     ctgatggcat acttgctaac ccaagattgg gaagggagga agtattggaa ggtgaacatc     37020
     cgcaagatgc tagattagcc cgacaaagca tttggttgag cccaagttta attgcggagt     37080
     atatacagct ttttttcaat tttattatag gaactatagg actgtctctt gctattaaat     37140
     tcattttgat gataagaaac gatgttaact taaaactgga gcataacgtg agggaagaat     37200
     tagataaaat tgcaacttgc aaatcaaggt attttgaaaa ccagtgcgaa cctcatatga     37260
     gggttccagc attggaggta cgttgcaatg aatggtcaaa atgtatgaac aaggaaatag     37320
     tgtctggctc cgattaccaa tgggctaaag catgggctcg tactctggcg gaggtaataa     37380
     atgctttttt tgaagcgttc agtatacgat ctttcctttt cattttaatt agcataatag     37440
     gtataatatt tgttaccaat acgagtttcg gatcatacag ggtttatctc aataataaag     37500
     atacaaaatc ggttcgccat gcatagtgta tataacttaa tctaatctgc acatttatat     37560
     tatttagatc catacgtcga tgaggatatg cgcaggaaag acataaagga atattgttat     37620
     ttcaaagatt ttctccactc cttaaacccg ttcgataata tatgttctcc atcaatcaaa     37680
     cctgaatatt cctcatcact ttcttcaatt tcggataatc ttaggtgatt attttcgaaa     37740
     accaacttaa atgctcttat ttgagaatga ggatcctcat ctcttggtat cattttcaaa     37800
     agccactcag taaggagacc ataccattta atggcttcta aacatgcact tccaacttgt     37860
     ggattattgt tctttaataa aacaggtact tcctccgttg aaaactcttc cacagttttt     37920
     aatacataat ggtcgtcttt aaaaccatat atgatccttg ggatcccaac taagaagcat     37980
     tgcagccagg tccggaacag tttacgctca aacttatgcg tatccgatat gttcgcaact     38040
     tgctgcgtac atttcaattc ggcataatgt tttaaattgt ctctaccgtt ttctttaaag     38100
     tcaaatatac aatccacctc agcaccaaga attaacttgc agttacctac accagttctc     38160
     acaacactaa tgtattcatc tccatgcgat acaatccttt tagttctttt ttctatcact     38220
     tcacggggtg tatactgcaa cggattggaa agagtagcca aagtttcaaa cttgtaccct     38280
     gtaaatacat tcagatcttg atttatatta cgccctgctt cagttgcaga ggaagcctta     38340
     gctgcattga cagcttcagg cacttccttg ataaaaagtt ggccgttgaa tgaaacgata     38400
     cgaagatcaa ctgtattaaa agatggagag tcaaatgcac atgaaattaa tttccgtgct     38460
     attcctctaa aagtaattat atcagcatta attttttttc ctttatgtct ttcagagctt     38520
     tctatggttt ctaatagccc acgcagggaa cacctgtctt caaaatcttt gtaataatcc     38580
     ttaaatttct gaaatcctga tgaaagatcc aacttcctgt ccaattcagc gtctggaaga     38640
     tagtagtaat tcaaattcgt atcatcgcta attaaatatt cttcatcctt agttcttgaa     38700
     tagaatccta tttcctttgg ctgcttcaga gctgttgtcg accctctttg ctttacgaac     38760
     aaatttgcac taacacccat tgggatacac tatgttggtc taatatttcg ctattctttc     38820
     accatattac agaagtatta gtaacattac cagacctcat ctgttcctaa tattctcgaa     38880
     gtaaattttt caatttaccc gaatgcttac tctttttttc ttcttcgtta aaagcaagat     38940
     aaagtgaaaa aaatggaaga taacttccat aagaatgacg aaactatttt caaaggttaa     39000
     ggaaagcata gaagggatca agatgccatc taccttgact attaatggaa aagccccaat     39060
     tgtggcttat gctgaactaa ttgctgctcg tattgtgaat gcgttagctc ctaactccat     39120
     agctattaag ttggtggacg ataagaaagc acctgctgcc aagctcgatg atgctactga     39180
     agatgtcttc aacaagataa ctagcaaatt cgccgccatc ttcgataatg gtgataaaga     39240
     gcaagttgct aaatgggtta atctggccca aaaggaatta gttatcaaga actttgctaa     39300
     attatcacaa tcattggaaa cactagattc tcaattgaac ctaagaacct ttattcttgg     39360
     cggcttgaag tattctgccg ctgatgtagc atgttggggt gctttaagat c              39411
//